KEGG   Candida dubliniensis: CD36_73940Help
Entry
CD36_73940        CDS       T01140                                 

Gene name
CMT1
Definition
S-adenosylmethionine-dependent methyltransferase, putative (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cdu  Candida dubliniensis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CD36_73940 (CMT1)
Enzymes [BR:cdu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CD36_73940 (CMT1)
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CD36_73940 (CMT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(998732..999484)
Genome map
AA seq 250 aa AA seqDB search
MSKETEFYNYITSLPEETLTQVKGKPLEVLKLIDEYPQSFMNIGPYKGKHIVAKIKEKAP
KTMIELGGYLGYSAVLFASEIADDPEAKYYSFELNPEFAKIANYVIGLAGLSDKVEIIVG
KASYNLPAFRKRLFSEKKHYTALDFIFIDHWKDMYVPDLRVLESLNLIAPGTLLVADNII
TPGAPQYVAYVNFSPDEKKLYNETTANPEGKEFIGRWNILYSTKTIEVVNPKNNHKDAIE
VTKCVDYFSG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacagaattctacaactatatcactagtctcccagaggagactctcact
caggtcaagggtaagccattagaagtcttaaagctcattgatgagtaccctcagagtttt
atgaacattggcccatacaaggggaaacacattgttgccaaaatcaaggagaaggccccc
aaaaccatgattgagttgggcgggtacttgggctattctgcggtattatttgccagcgaa
atagccgacgatccagaggctaaatattacagttttgagcttaacccagagtttgctaaa
attgccaactatgtaatcggcttggcagggttgctggataaagtcgaaatcattgtcggc
aaggcgtcatacaatttgccagcatttagaaaaagattgttttcggaaaagaaacactac
actgcgttggactttatctttattgatcactggaaggatatgtacgttccagatttacgg
gtgttggagtcgctcaatctcattgccccaggaacattgcttgtggccgacaatattatt
acgccaggtgctccacaatacgtggcatacgtaaacttttccccagatgagaaaaagcta
tacaacgaaaccaccgcaaaccccgagggtaaggagtttataggcagatggaatatcttg
tattcgacaaaaacaatcgaggtcgtcaaccccaagaataatcataaagatgcgattgaa
gtgactaaatgtgtggattatttctctggataa

DBGET integrated database retrieval system