KEGG   Candida dubliniensis: CD36_73940Help
Entry
CD36_73940        CDS       T01140                                 

Gene name
CMT1
Definition
S-adenosylmethionine-dependent methyltransferase, putative (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cdu  Candida dubliniensis
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cdu00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(998732..999484)
Genome map
AA seq 250 aa AA seqDB search
MSKETEFYNYITSLPEETLTQVKGKPLEVLKLIDEYPQSFMNIGPYKGKHIVAKIKEKAP
KTMIELGGYLGYSAVLFASEIADDPEAKYYSFELNPEFAKIANYVIGLAGLSDKVEIIVG
KASYNLPAFRKRLFSEKKHYTALDFIFIDHWKDMYVPDLRVLESLNLIAPGTLLVADNII
TPGAPQYVAYVNFSPDEKKLYNETTANPEGKEFIGRWNILYSTKTIEVVNPKNNHKDAIE
VTKCVDYFSG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacagaattctacaactatatcactagtctcccagaggagactctcact
caggtcaagggtaagccattagaagtcttaaagctcattgatgagtaccctcagagtttt
atgaacattggcccatacaaggggaaacacattgttgccaaaatcaaggagaaggccccc
aaaaccatgattgagttgggcgggtacttgggctattctgcggtattatttgccagcgaa
atagccgacgatccagaggctaaatattacagttttgagcttaacccagagtttgctaaa
attgccaactatgtaatcggcttggcagggttgctggataaagtcgaaatcattgtcggc
aaggcgtcatacaatttgccagcatttagaaaaagattgttttcggaaaagaaacactac
actgcgttggactttatctttattgatcactggaaggatatgtacgttccagatttacgg
gtgttggagtcgctcaatctcattgccccaggaacattgcttgtggccgacaatattatt
acgccaggtgctccacaatacgtggcatacgtaaacttttccccagatgagaaaaagcta
tacaacgaaaccaccgcaaaccccgagggtaaggagtttataggcagatggaatatcttg
tattcgacaaaaacaatcgaggtcgtcaaccccaagaataatcataaagatgcgattgaa
gtgactaaatgtgtggattatttctctggataa

DBGET integrated database retrieval system