KEGG   Candida dubliniensis: CD36_80450Help
Entry
CD36_80450        CDS       T01140                                 

Definition
histone acetyltransferase subunit, putative (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CD36_80450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:72690..74315
Genome map
AA seq 541 aa AA seqDB search
MAVAEIKKEKGSSMSPAPSSPIQILSTEPDANPDSKQEKFTPKDILPGCKVHVSKDGELR
LAEILQEHIKKGRKVFYVHYQDFNKRLDEWIELDRIDFTRSLILPEIKTDTKENKSKKKS
KSKGSTKSSKNNTTANSTTGTPQPNDGQPIMGDDEMDLENLNVQGLKRPGEEFSREDEIK
KLRTSGSMTQNHSEVARVRNLSTIILGEHIIEPWYFSPYPIELTEEDEIYICDFTLSYFG
SKKQFERFRSKCSMKHPPGNEIYRDSKVSFWEIDGRKQRTWCRNLCLLSKLFLDHKTLYY
DVDPFLFYIMTIKSDQGHHVVGYFSKEKESADGYNVACILTLPCYQKRGFGKLLIQFSYM
LTKVERKVGSPEKPLSDLGLLSYRAYWTDTLVKLLVERNSPALFRKNNPQLEYDEAENGK
DGSATPTPGPGSYASQFSTSASALASRSGLNSSPVFSNEITIEDISSITCMTTTDILHTL
TTLQMLRYYKGQHIIVLTDQIMELYEKLVKKVKEKKKHELNPKLLNWTPPSFTANQLRFG
W
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagcagaaatcaaaaaagaaaaaggctctagcatgtcacctgcaccctcttcg
cccattcaaatactaagtactgaacctgatgcaaatcccgatagtaaacaggagaaattt
acaccgaaagatatattgccgggatgcaaagtgcatgtttctaaagatggggagctcaga
ctagcagaaattttacaagaacatattaagaaaggccgtaaagtgttctatgtgcattac
caagatttcaataaacgtttagatgaatggattgaactcgacaggatcgactttactcga
agtctaattttaccagaaataaaaacagacacaaaggagaataaactgaaaaagaagagc
aaatccaaaggcctgacaaagctgtccaaaaataataccactgccaatagtacaactggt
accccacagccaaatgatggacagcctattatgggagacgatgaaatggatttggaaaac
ttgaatgtccaaggattaaagcgtcctggagaagaatttagtagggaagacgaaatcaaa
aagttacgtactagtggttccatgacccaaaatcatctggaagttgcaagagtaagaaat
ttatcaactattatattgggtgagcacatcatagaaccatggtacttttccccgtaccct
atagaattgacagaagaagacgagatatacatttgtgactttacactttcctattttggg
tccaaaaagcaatttgagagatttcgctccaaatgttcaatgaagcatccgccaggtaat
gagatatacagagattcaaaagtcagtttttgggaaatagacgggagaaagcaaagaacg
tggtgtcggaatttgtgtctattgagtaaattgtttcttgatcataagacattgtactat
gatgttgatccctttttgttctatataatgactatcaaatctgatcaaggtcatcatgtt
gtggggtatttttccaaagaaaaagagagtgcagatggatataatgttgcatgtatatta
actctaccctgttatcaaaagagagggtttgggaaattattgatccagttttcgtacatg
ttaaccaaagttgagagaaaagtgggatcgcctgaaaaaccattatcggatttgggatta
ttgtcatatcgtgcctattggacagacacattggttaaactattagtggaaagaaacagt
cctgccttattccgcaagaataatcctcagctagaatacgatgaagcagaaaatggcaaa
gatggctctgcaactccaacaccggggccagggtcatatgcttcccaattctcgacatca
gctagtgcccttgcttcacggctgggactaaattcatcgccagttttttctaatgaaatt
accattgaggacatttcatcgataacatgcatgaccacgaccgatatattgcacacattg
accacattgcagatgttgcgatactacaagggacaacacataattgtgttgaccgatcaa
ataatggaattatacgaaaaactagtcaagaaggtgaaagagaaaaagaagcacgagtta
aatccaaaattattgaactggacgccgcctctgttcacggcaaaccaattacgattcggg
tggtaa

DBGET integrated database retrieval system