KEGG   Candida dubliniensis: CD36_81040Help
Entry
CD36_81040        CDS       T01140                                 

Definition
protein disulfide-isomerase precursor, putative (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cdu  Candida dubliniensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CD36_81040
Enzymes [BR:cdu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CD36_81040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:235349..236575
Genome map
AA seq 408 aa AA seqDB search
MKLLSTTLLLYFFSTSLVLSYTTSNIIQANDNNLQSLIKTPGKFSFVDFYADWCRHCKKI
SPIIDELSELFIDYPEIQIIKINGDKDGKKMSKKYVDIGYPTLLFFYDDGEKKIEFDGIR
DLNSLSNFIQQLSGIRLKNESEKGAVNNIEEKESSSNVNGVVEQTNNKLIELTPDNFDEK
ISQSPISIVSFGASWCKYCQELDPALDKLANEVYIRDIDDNKIMIGHLIIDQYKDNSIDE
RYNIQDLPTVLFFRRNGNGDDDLQTPLVYKGKKNFYNLLNDINKFTGLNRDSQGNLNNDA
GIIKEISQLIKNFNSDDHDHNDDGDELEIYDQLEKFKTTTTSGGGSGSGSGSSGGDDVEY
YEKLINAKEYIPIELSRINNILQNDIDKLNGITIDSLTKRANILKSLL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctatcaacaacattattattatattttttttccacatctttggtattatca
tatacaacatcaaatataattcaagcaaatgataataatttacaatcattgataaaaaca
cctgggaaattttcatttgttgatttttatgctgattggtgtcgtcattgtaaaaaaatt
tctcccattatagatgaattaagtgaattatttattgattatcctgaaatacaaataatt
aaaattaatggtgataaagatgggaaaaaaatgagtaaaaaatatgttgatattggatat
ccaacattattatttttttatgatgatggtgaaaaaaaaattgaatttgatggaattaga
gatttgaatagtttaagtaattttattcaacaattgagtgggattagattaaaaaatgag
tcagaaaaaggggctgttaacaatattgaggagaaagaaagtagtagtaatgtaaatggt
gtagttgaacagactaataacaaattgattgaattgacaccagataattttgatgaaaaa
atatcacaatcaccaatatctattgtatcatttggagcatcatggtgtaaatattgtcaa
gaattagatccagcattagataaattagctaatgaagtttatattcgtgatattgatgat
aataaaattatgattggtcatttaattattgatcaatataaagataattcaattgatgaa
cgttataatattcaagatttaccaacggtgttatttttcagacgaaatggtaatggtgat
gatgatttacaaacaccattagtttataaagggaaaaaaaatttctataatcttttgaat
gatattaataaattcacaggattaaatagggattctcaaggaaatttaaataatgatgct
ggaattattaaagaaattagtcaattaattaaaaattttaatagtgatgaccatgaccat
aatgatgatggtgatgaattggaaatatatgatcaattggaaaaatttaaaactactact
actagtggtggtggtagtggtagtggtagtggtagtagtggtggtgatgatgttgaatat
tatgaaaaattaattaatgctaaagaatatatcccaatcgaattatcaagaattaataat
attttacaaaatgatattgataaattaaatggaatcactatagattctttaactaaaaga
gcaaacattcttaaactgttattatag

DBGET integrated database retrieval system