KEGG   Candida dubliniensis: CD36_81250Help
Entry
CD36_81250        CDS       T01140                                 

Definition
glucan 1,4-alpha-glucosidase, putative (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cdu  Candida dubliniensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cdu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(291708..293384)
Genome map
AA seq 558 aa AA seqDB search
MRSLSLSFNLFIIFIINLGYVNSFLIPIKGLNLLPLQQQKHQQSIFSNNFKSTPSPTSFD
DWLVFQKQVCLNSILNNIGGDFTIDNKDLLPGVVIASPSTSNPDYYYQWTRDSAIIINIL
IDHVSQTPLYFKKNSTSSLIRIIESYIFNNQVLQQLPNLSGDVDNLQNLGEPKFHVNLTA
FNESWGRPQRDGPGLRSITIMNYLSLLNNTEQITTFSNLTINDTQKIYHDIIKPDLQYSI
EYWQFEGFDLWEEIKGIHFFTSLIQLKSLTMGLKFAEFYNDSFEFRLDLMNSIKLLTKYI
ELEAGFINGADSDDDESEQQLLSKSYIISSPKFFYTKSRSGLDIATILAVLYTHNNNDEV
DDFPFDVDNGLVLTTLRYLIQDMTFRYPINFQDNFQGVALGRYPEDIYDGHGKSEGNPWF
ISTATASELIYRLIYKLKLNNQDIIIDQHNIEFYEQFIQSITAISSNNKQNLKDHTISGH
PIMIINKDDQLYDELINKLFHYADGFLKVVQKHIDNNGDMNEQFNKYIGFMQGAKKLTWS
YGAVFTAINWRNKTLSIL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagatcattgtcattgtcatttaatttatttattatctttatcattaatctaggttat
gttaattcatttttaataccaataaaaggactaaacttgctccctctacagcagcaaaag
catcaacaatcaatattctcaaataattttaaatcaacaccgctgccaacttcatttgat
gattggttagttttccaaaaacaggtttgtttaaattcaatacttaataatattggtgga
gatttcactattgataacaaagatttattacctggggtggttatagcatcaccatcaact
tcaaatcctgattattattatcaatggacaagagattctgctattataattaatattttg
attgatcatgtatcacaaactcctttatatttcaaaaaaaattcaacttcaagtttaatt
cgtattattgaatcatacatttttaataaccaagttttacaacaattacccaatttatct
ggtgatgttgataatttacaaaatttgggtgagccgaaatttcatgtcaatttgacggca
tttaatgaatcttggggtcgtcctcaacgagatggaccaggattaagatcaattaccata
atgaattatttaagtttattaaataatactgaacaaattacaacattttctaatttgaca
ataaatgatacccagaaaatatatcatgacattataaaacctgatttgcaatattcaatt
gaatattggcaatttgaaggatttgatttatgggaagaaattaaggggatacattttttc
actagtttaatacaattgaaaagtttaactatgggattgaaatttgctgagttttataat
gattcattcgaatttagacttgatttaatgaatctgattaaattattaactaaatatatt
gaattagaagcgggattcatcaatggtgcagacagtgatgacgatgaaagtgaacaacaa
ttgctttcaaaatcatatataatttcatccccaaaatttttctatactaaatcaagaagt
ggattagatattgccaccattcttgccgtattatatacccacaataataatgatgaggtt
gacgatttcccatttgatgtggataatggattggtattaacaacattaagatatcttatt
caagatatgacatttagatatccaataaattttcaagataattttcaaggagtagcatta
ggtcgatatccggaagatatttatgatggacatggtaaatcggaaggaaatccttggttt
atcagtacagcaactgcaagtgaattgatttatcgattaatttataaattgaaattgaat
aatcaggatattataattgatcaacataatattgagttttatgaacagtttatccagagt
ataaccgcaattagttccaacaataaacaaaatttgaaagaccatactattagtggacat
ccaattatgataatcaataaagacgatcaattatatgatgaattgatcaataaattattt
cattatgctgatgggtttttaaaagttgttcaaaaacatattgataataatggtgatatg
aatgaacaatttaataaatatattgggtttatgcaaggagcaaaaaaattgacttggagt
tatggagctgtatttacagcaattaattggcgtaataaaactttatcaattttatga

DBGET integrated database retrieval system