KEGG   Candida dubliniensis: CD36_82440Help
Entry
CD36_82440        CDS       T01140                                 

Definition
cytochrome c peroxidase, mitochondrial precursor, putative (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CD36_82440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(582085..583182)
Genome map
AA seq 365 aa AA seqDB search
MATFAPNISKITKTSAKFNYGRIAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNGNSK
NVAKALFGVGTGANIKTAKVPEGKTANDYQKVYNDIATKISENLEFDENSGYYGQLLRLA
WHTSGTYDKSDNSGGSYGGTMIFAPEEFDPENAGLQVGREFLMEFLVKYPWISRGDLWTL
GGVAAVQESGGPKIEWRPGRVDDNTASKVPPNGRLPDASRDGKYVKDLFARMGFNERETV
ALLGAHVLGRCHKHNSGYDGPWGPSFNQFTNVFYTTLLGDWHIKKWNGKKQYEDDETGEF
MMLPTDMALKEESYFLKYVKMYAEDQDLFFKDFAKAFSKLISNGIKYPADSKPILFKTLD
EQDEE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctacttttgctcccaatatcagtaagattacaaaaacttcagccaaattcaattat
ggtagaattgcaaagacatttcttggggtagctggttctgccgctattgccacttatttc
tataacaatggaaatccattcaacaacaacaacaataataacaacaacggaaattctaaa
aatgtagctaaggcattatttggagttggtactggagccaatatcaaaacagccaaagtt
ccagaagggaaaactgctaatgattatcaaaaagtttataatgatattgctaccaagatt
tctgaaaatttagaatttgatgaaaattctggttattatggtcaattgttaagattagca
tggcatacttctggtacttatgataaatcagataattctggtggttcatatggtggtacg
atgatttttgctccagaagaatttgatccagaaaatgctggtttacaagttggtcgtgaa
tttttaatggaatttttagtgaaatatccatggatttcaagaggtgatttatggacttta
ggaggggttgctgctgtacaagaatcgggtggtccaaaaattgaatggagaccaggtaga
gttgatgataatactgcatctaaggtaccaccaaatggtagattacccgatgcttcaaga
gatggtaaatatgtaaaagatttatttgctagaatgggatttaatgaaagagaaactgtt
gctttacttggtgctcatgttttaggtagatgtcataaacataattctggatatgatggt
ccatggggtccatcatttaaccaatttactaatgtcttttacacgaccttattgggtgat
tggcacattaagaaatggaatggtaaaaaacaatatgaagatgatgaaactggtgaattt
atgatgttaccaacagatatggctttgaaagaagaactgtatttcttgaaatatgtcaag
atgtatgctgaagatcaagatttgtttttcaaagattttgctaaagcattttctaaattg
atttcaaatggtattaaatatcctgctgatagtaaaccaatattattcaaaacattagat
gaacaagacgaagaataa

DBGET integrated database retrieval system