KEGG   Candida dubliniensis: CD36_83880Help
Entry
CD36_83880        CDS       T01140                                 

Definition
histone H2B.1, putative
Orthology
K11252  
histone H2B
Organism
cdu  Candida dubliniensis
Brite
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CD36_83880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(861156..861548)
Genome map
AA seq 130 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTDGAKKRTKTRKETYSSYIYKVLKQTHPDTGISQ
KAMSIMNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSASS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaagcagaaaagaaaccagcttctaaagctccagctgaaaagaaaccagct
gctaagaaaaccgcttccaccgatggtgctaagaagagaactaaaactagaaaagaaacc
tactcctcatatatatacaaggttttgaaacaaacacatccagacacaggtatttcccaa
aaggccatgtccatcatgaattcatttgttaacgatatttttgaaagaattgccactgaa
gcttctaaattggctgcttacaataaaaaatccacaatttctgccagagaaatccaaact
gctgttagattgattttgccaggtgaattggccaaacatgccgtttcagaaggtaccaga
gccgttacaaaatactcatctgcttctagttag

  All links  
No link information was found.   
DBGET integrated database retrieval system