KEGG   Candida dubliniensis: CD36_84150Help
Entry
CD36_84150        CDS       T01140                                 

Definition
arginase, putative (EC:3.5.3.1)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cdu  Candida dubliniensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CD36_84150
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CD36_84150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:922267..923532
Genome map
AA seq 421 aa AA seqDB search
MKFHIFALLACVSSQAIFKSPSLLDQLYGELHGRTNTAPNLQIQADDPNQMTVQKVLSMR
SKLKLPDKDDTSDIAVDQNMFGGILTYAHFNHFNCFISNENNEFDKHSTLDQQTTRNIDV
AIVGAPFDTGTSYRPGARFGPESIRSNARRLGSAWKSTKKRFNYPVDPYDETTHNYSIID
CGDVAMTPFDNRIALNQLYRGHRSISKHQGNVNQHPKIITLGGDHTITIMAIKNVYEQLG
RKIRVFHFDSHIDTWDPKKLGGGITDYMSLNHGTFLHYATELGYIETKGNYHIGIRAPYI
DANYDKQHDADCGFHIIQANDIDKIGVQGIIDELTKDPDIPTYISVDIDVLDPAYAPGTG
TMEVGGFTTRELLAILDGLKNKVNVIGGDVVEVSPPYDTNSEITSLAATSVVDSLLKLMI
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcacatttttgctttacttgcatgtgtatcatcacaagccattttcaaatca
ccatcacttctagatcagttatatggagaattacatgggagaacaaacactgctccaaac
ttgcaaatacaagcagatgatcctaatcagatgacagtacaaaaggttttatcaatgaga
tccaaattgaagttgcctgataaagatgatacttccgatattgctgttgatcaaaacatg
tttggtggaatcttgacttatgcccatttcaatcattttaattgtttcatctctaacgaa
aataatgaatttgataagcactccaccttagatcaacaaacaaccaggaacattgatgtt
gcgattgttggggcaccatttgataccgggacatcctatcgccccggagccagattcgga
cccgaatcaatcagaagtaatgctagacgtttaggaagtgcttggaagtcaaccaagaag
agattcaattacccagttgacccttatgatgaaactactcataattattccattatagat
tgtggtgacgtggctatgactccatttgataatcgtatcgctttaaatcaattgtatcgt
gggcatagaagcatttctaaacatcaagggaatgtcaatcaacatcccaaaatcatcaca
ttgggaggtgatcatactataaccataatggcaataaaaaatgtttatgaacaattagga
agaaaaattagagtatttcattttgattcacatattgatacttgggatcccaagaaattg
ggtggtggaatcactgattatatgtcattaaatcatggaacattcttacattatgccacc
gaattagggtatattgaaacaaaaggtaattatcacatcgggataagggcaccatatatt
gatgctaattacgacaagcaacacgatgctgattgtggattccatattatccaagctaac
gatattgacaagattggagttcaaggaatcattgatgaattgacaaaggacccagatatc
ccaacttatatatcggttgatattgatgtattggacccagcctatgccccaggaacagga
acaatggaggtaggtggatttaccaccagagaattgttggccattttagatgggttgaaa
aataaggttaacgtgattggtggtgatgttgtggaagtgagtcccccatatgatacaaat
agtgaaatcacaagtttggcagccaccagtgttgttgattcattgttgaagttaatgatt
gtctaa

DBGET integrated database retrieval system