KEGG   Candida dubliniensis: CD36_85190Help
Entry
CD36_85190        CDS       T01140                                 

Definition
dynein heavy chain, cytosolic, putative
Orthology
K10413  
dynein heavy chain 1, cytosolic
Organism
cdu  Candida dubliniensis
Pathway
Phagosome
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    CD36_85190
Chromosome [BR:cdu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      CD36_85190
Exosome [BR:cdu04147]
 Exosomal proteins
  Proteins found in most exosomes
   CD36_85190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1182787..1195266)
Genome map
AA seq 4159 aa AA seqDB search
MEESVTPLLSVNQLYDCIIGFLPFDENVPEFAQCEDVLSKFISNNNQDTLYLIKSIEEKT
SRISNDLSDLDMSFKDLDTFVIIIKSKGELRSDIPLTQQLNIMSIPIPQNESHETNDSFE
KLRLAVSLGLAPYFDFISTKNEESALATTKKKFNELSLALQHLQQRIHIPDLLITTHPKI
KMLITEKDGEYPDELIEDTEFLNELTSITNNWVRQIQSITRLNHEPSDGESIMEDIQFWK
SMDLALISLNQQINSPEVKLTRELLSKAKRFHITLSFENDIGLKEKLTETKLYNSFLREL
PIHDLSTITEDDGFQKFDNALTNIFSHLKLKLNLLPLERAMKSVDVILNDITDKLQALLG
TYDLMSLSLDKFEEIISLCNKELDTIEVNVKFIINLLRELLRKRQEKFKLIKIDQTRLQN
IKERLLYLRQFRHNHQNLMAGIESVLPQEEQIDSISKLNEAYNKHIISINPVDISHQGKL
IWSMNEHAYLEVFHNLNSLLTKKINKFFNNAHTFIDFITIYKNFFVGENSSSLLQSISDD
HKLKILTIADSEIQQLVELNSDHVSVSSFSSIKWKIQLSAKLKFYRDYLELLLGFNWKSY
SVGTKIDTTTNKLLESLDPATAIDKWVEQEVNQNLPSANLGKILTISENSQERFDLNINF
NFQMFEIYRQLSQLYNLGYSLPSLTMLQFEKISQLYPITNIIKDHVQLLNRLFNVDLQKA
YGKAFGFLVATQIKKVREMLKETMNIEWVHLLHAVELHEVNDNDFKSTENLIEYRSMRQL
TEFQDSITQLNLSLIKLKNFSKFMDQCKFLLRTANFEFSCIERHLKTLQQEFNNISLEKI
ENIEGLANLINLEVQSVLRERLQTQLFIFNIKAMAYNDEQEIEIIELNKYLLDFPIFKHY
LSFNDETFVIEPPLNTGKQSAFEQLNHIVSIVERQHMIRPLTSHSQSFSSVAEDENSMKQ
LNSVFEKIETLYQDAESYISKWGLLQNLWELNLDDPDDFAKLFKADQTVDSWFEVVQEIF
KYRNIYDLPDPEKAFGYLFVINITKVQHRVAIKFEALQKSLLSKFSKKIDQESNSFNRLL
INAKQILETPLTFHDSTEQLISGIDSYLKYQNNLQNWNLLLETFQSVQSFLVKYRFKFPN
DWLYAEQLENNISMVQALVAKKSLLIEENLEIVSSKIKAEALKVNDSINSLNQNWQSKKP
IAGNLNPSVAMMDLDNFQMHFSKLTSYVESLSNISNHLHINIVSFEDMTLSIDEIKDLKS
VWSSVNGLWEELERLKKIKWSDLQPRQLRHNLDDLLNSARNLPMNIRQYSAVDEIQASVK
THLKTHQKVSDLKNGAMKPRHWKILLSQLGVPNINFEDLTVGDVWGLNITLNIQTINAMV
EQANSEKTIEENLNNINNSWASITFELFNYENKCRLVKNWEQLIDQCNTDINALASMKNS
PYFGAFEREISELEKKLTQLFIVLDIWIDVQRQWLYLEGVFGNENNDLKSLLPIESSRFT
NISYEFLNLLKRIYKFNLVIDIVLITDLQPMMTKCFESLVKVRKSLTDYLEKQRELFPRF
YFIGNEDLLELVGGSHDITRINNHLKKMFSGVEKLQYAKESSCIIGVVSEQGEQLVLHNP
VSLIKHTRLHEWLSELELEIKLTLSHLVKDNIKVWQESVFKKDGLVPLIDSIPAQVATLL
QQVTFTGLIEDPTTSLSSLHENLSDTIKTLVRAIGSEIVDLTRKKTQYLIIEIIHQRDVV
EQLMNAESESDRKFIRSIQQRFYYDISNTDLLKSLTIKQANSEFVYGFEYLGIPEKLAYT
PLTNDCYLAMCQALSIQQGGSPFGPAGTGKTESIKALGHNLGKMVIVFCCDDSFDFQSMG
RIFLGLCKVGIWGCFDEFNRLDDKILSAISSQIESIENGLKNPNMTISVSEKNVKVNPET
GIFITMNPGYAGRVELPENLKKMFRSFSMDSPDNEIIVEILLTSQTFVNSKALAKSIVPF
FQELASSTSKQLHYDFGLRALKNTLVRCGHAKRKSANANETLAFEQELVAQSIVETILPK
LIKEDEIVFEKLRNKYFANVVGKVLDKSKLITALEEYFTKNGVQFDEKFVNKALQLIDIQ
NTHHGIMLVGESGSGKSTILDSIMYALSVVTNVEHTKVLIDAKVLSKDEIYGKLDLVTRD
WTDGLFTSVLRKMSENLRGELSRKLWIVFDGDIDPQWAENLNSVLDDNKILTLPNGERLS
LPENVRIVFEVDNLEYTTPATISRCGIVWFDVSLISLDAHLHKLVHQLNKFKITNDDMIG
DNMLADNLKISFVEELNHLLSHNVLSGICEIAKQVDHIMEFSFQRAIGSLEVYLKTYLRR
LLSFANSKDYETVEMKKYVQKALLLSIMWTFAGDSSYEGRIEFAKTIKDKKMFWGVEMPN
DNVLDYDISLPEGEWLDWNTFVASVELEPHQVSNPNTIVPTLDTVKHEQLIFSVLNEHSP
LLLCGPPGSGKTMTLFEALRKSPQLELLSLNFSKETSPVSLLKALDQYCEYRKTNRGIQL
APRINGKWVVVFCDEINLPQVDKYGNQNVISLIRQMVEHGGFWRVKDNQWVSLENIQFVA
ACNSPNDPGRNKLSERFLRHVPVIMVDYPGYTSLTQIYQTFNMAILKCAPDLRGFAKAVT
EASIQVYERTRRKLNSGIQKHYVYSPRELTRWSKGILEALKSHVYKDLSAFLRLWYHEGL
RLFYDRLVTDDDKSWTLQLFKEVAERNFPNINLDATFKEPVFFSNWMSLNYKSVNEQELR
SFVSERLRVFSEEEMEVDLVLHDEMLDHALRIDRVLRQPQGHMILVGPSGSGKSTLAKFV
AWINGLKVVQLQVRSNYGIDEFDEALRGILTRCVHGEKICFVIDESSILEASFIERMNTL
LANAEIPGLFEGEDYTSLMSKCLELSHSQGLLLDTDTELYDWFTQQISKNLHVVFSISDS
IESTSQSVISSPALFNRCVLSWMGDWSDRCLYEIASSRISIVPLDISNYVVPNTFTPFLS
NRRAKNLRDAIVDTLAFIHRFIPDHKSTISYRRTPTDFLNLVQMFTDLFSIKHKELEDSQ
RHITVGLDKLRETVIQVDKLQRMLSEKESILKTKDKEAKEMLNKLLTDQNEAERKQEFSI
ATQAELEKQEKEIEKRKSVVMKDLEYAEPAVLEAQRGVQNIKKQHLSEIRSMANPPAAVK
MTMESVCILLGYDVGTWRDVQLVIRKDDFIPNIVSFNSEESLPVELRKYMERVYLTREDY
TFEIVHRASKACGPLVQWVQAQLAYSRILQSVGPLREEVELLEQKTLKTKAQLTAIDEMI
FELEESIEKYKDSYTELIRETENIKTEMALVHKKVDRSTTLIKNLKVERERWKESVKLFG
DKRDKLVGEVLLAAAFIVYGGLYDQKGREILLKTWRNKLKESGIPFDETHTMSSYLATSK
KALHWTNCGLVNDNINIENFALLEWCQNPVIIDPNGVIVDILSKVSSKSVTVTSFLSDGL
LNQLENALRFGGLIIIQDCEYYDPLLDTVLRKEIHRNGGRMMIRLGDQIIDYSSEFKLIL
ASKESELVLPPSVASRVSIINFTITSGSLENRALDIALKETRPDVEKERTDLVMLNGEWK
LRLQTLEEELLDSLSKTPGEILDNDSVMQTLETLKTETDGLNEKLAHSGEVMNRVEEIRN
NYSDVAKNLSGIYTIFESLGRLNHFYRFSLTRFVSNFAHLLRESINLSPSEFIMELYKDS
FAHISTSLQYQHKIVLSLVLSTAYYMEDIGDSYKTAFMKTLKLIVTEKLPNSVNEVFDVC
LARRESGWDVEKVLEMNQDNSVLQMLSDLLLSFNNTRNSEDFVDTFSKISGFLFKDGEAP
YSSPYNLDYWINELGIRTIILTCPEVYDASYKVEQSARQFNKKLSVISMGTKEGIEMANK
EIEAASMSGRWVLIQNIHMAPSWISHFENQLTNLHAESKIFLTCKNDSQVPIGVISQCKV
LNFENEVGIQRIVLDTYKSSSMEKRERIERHVLLLLIWYHSVILERVRYSPVSFKKKYDF
NDSDYSCGVHIIEKVFESYDGKTETIPWNEIKYLIATITYGGKVDDKEDLAFLETFASDI
FTERSFDQNFNLIDNEFTKESNEVLPLPDTTEEIELWINKLPYETPLSWIYLPEDANSLV
KKQLGLEVVESVLDLSEVL
NT seq 12480 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactggtaacacccttattatcagtcaatcaattatatgactgtataataggt
tttctaccttttgatgaaaatgtaccagagtttgcacagtgtgaggatgtgttaagcaag
tttatatctaacaacaatcaagatactttgtatcttatcaagtctatcgaagaaaaaaca
tccaggatttccaatgatctttcagatttggatatgtcattcaaagatttagataccttt
gttattataatcaaatcgaaaggtgaacttagaagcgacataccacttactcaacaacta
aatattatgagcattcctattccccaaaatgagagccacgagaccaatgatctgtttgaa
aaactcagattggcagttagtttagggttggcgccatattttgactttatttcaacaaaa
aatgaagagtcagcattggctacaacgaaaaagaagttcaacgaattatcattagcattg
caacatttacaacagagaatccatattccagatctattaatcacaactcatccaaagatt
aagatgttgattacagaaaaagatggtgaataccctgacgaattaatagaagacactgaa
tttttgaacgagttaacatcaattactaacaattgggtccgacaaattcaatcgatcact
cgtttgaaccacgagccgtcagatggggaaagtattatggaagatatccagttttggaaa
tctatggatttggcattaatatctttgaaccaacaaatcaattctccagaagtgaagctt
actcgagaattgttatctaaggccaaaagatttcacattactttgagttttgaaaatgat
attggattgaaggaaaagttaactgaaaccaaattatataattcatttttaagggagctt
cccattcatgatttgctgaccatcaccgaggatgatgggtttcagaagtttgacaatgcc
ttgaccaacatctttagtcatttaaaactaaaattaaacttattgccattggaaagagca
atgaaatcagttgatgtaattttgaacgatattaccgacaaattacaagcattattaggc
acttatgatttaatgtcattatcgctagataagtttgaagaaataatcagtttatgcaac
aaggaattagacaccatagaagtgaatgtcaagtttataatcaatttattgagagaattg
ttgagaaaacgtcaagaaaaatttaagttaatcaaaattgatcaaaccagacttcaaaat
attaaagaacgattattatatcttagacagtttagacataatcatcaaaacttgatggct
ggtatagagagtgttttaccacaggaggagcaaatagatctgatcagtaaattgaacgag
gcgtacaacaagcacattatcagtatcaatcctgttgatatatcgcaccagggaaagttg
atctggtcaatgaatgaacatgcctatctcgaggtgtttcataacttgaattctttactt
acaaaaaagataaacaagtttttcaacaatgcccatacatttattgattttattaccatt
tataaaaacttttttgttggagagaattcgagttcgttgttacagctgatcagtgatgac
cataaattgaaaattttaacaatagccgatagcgaaatccaacaacttgtggaattgaat
tcagatcacgttctggtatcgagcttctcttccatcaagtggaaaattcaactcagtgcc
aaattgaaattctatcgtgattacttggaattacttttggggtttaattggaagagttat
tcggtgggtacaaaaatcgacaccactacgaataagttattggaaagtttagacccggca
acagcaatagataaatgggttgagcaggaagttaaccaaaatttacctagtgccaattta
gggaagattctcaccatatctgaaaattcccaggaaagatttgatttgaatatcaatttc
aactttcaaatgtttgaaatttacagacaacttagtcaattatacaacttgggatattcg
ttgcccagcttgacgatgctacaatttgaaaaaatcagtcaattatacccaatcacaaac
attatcaaggaccatgtgcagttgcttaacaggctctttaatgtcgatttacaaaaggct
tacggtaaggcatttgggttccttgttgctactcaaatcaaaaaagtaagggaaatgttg
aaagaaaccatgaatattgaatgggttcatttattacacgcagttgaattacacgaggtt
aatgataatgactttaaatcaacagaaaatttaatcgaatatcgatctatgagacagttg
acagaatttcaagattctattacccagttaaatttactgttgatcaaattaaagaatttt
tccaagtttatggatcaatgcaaatttttattaagaaccgctaactttgagtttagttgc
atcgaaaggcatttgaaaacattgcagcaagagtttaacaatatttctttagaaaagatt
gaaaatatcgagggtttagctaatttgattaacttggaagtacaatctgttttgagagag
cgattacaaactcaacttttcattttcaatatcaaagctatggcttacaatgacgaacaa
gaaattgaaattattgaacttaacaagtatttgttggactttccaattttcaagcattac
ttaagcttcaatgatgaaacttttgtcatagaacctccgttgaacacaggaaaacaactg
gcttttgagcaattaaatcatattgtttcaatagtcgagagacagcacatgataagaccc
cttacatcacattctcaaagtttttcctctgttgccgaagatgagaattccatgaaacag
cttaactcagtttttgaaaagattgaaactttgtatcaagatgcagaactgtatatatcc
aaatggggattattacaaaacttatgggaattaaacttagacgatccagacgattttgcc
aaactatttaaggctgaccaaactgtggattcctggtttgaagtagttcaagagattttc
aaatatagaaatatttatgatttacctgacccagaaaaggcatttggatatttgtttgtg
attaatattactaaggtacaacacagagttgcaataaagtttgaagctttacaaaaactg
ttattgagtaaattttccaaaaaaattgatcaagaatccaattcatttaaccggttgttg
atcaatgctaaacaaattttagaaacaccacttacgttccacgatagtaccgaacaattg
atttctggtattgatagttacttaaagtatcaaaacaatttgcaaaactggaatctttta
ttggagacttttcaactggtacagagttttttggtgaaatacagatttaaattccctaat
gattggctttatgctgaacagttggaaaacaacatctcaatggtacaagctctcgtcgcc
aaaaaaagtttactcattgaagaaaatcttgaaattgtttcttctaaaatcaaggccgaa
gctttgaaagttaatgattctataaattcgttaaatcaaaactggcaatcaaagaaaccc
atagcagggaacttaaatccatcagtggccatgatggacttggataattttcaaatgcat
ttttcaaaattaacgtcttatgttgaatcattactgaatatttccaatcatttgcatata
aacattgtttcatttgaagatatgaccttatcgattgatgaaattaaagatcttaaatca
gtttggtcttcagttaatggattatgggaagaacttgaaagattgaaaaaaattaaatgg
agtgatctccaaccaagacaattacgtcacaatttggacgatttattaaattcagcaaga
aatcttcccatgaatataagacaatattcagctgttgatgagatccaagcttcagttaaa
actcacttgaaaacccaccaaaaagtttctgatttgaaaaatggggccatgaaacctcgt
cattggaaaatattgttaagtcaattaggagttccaaatattaattttgaagatttaact
gttggtgatgtatgggggttgaatatcacgttgaatatccagacaattaatgctatggta
gaacaagccaatagtgagaaaacaattgaagagaacttgaacaatataaacaacagttgg
gcgctgattacatttgagttgttcaattatgaaaacaagtgccgtttggtgaaaaattgg
gagcagttaattgaccaatgtaatactgatattaatgctttggctagtatgaaaaattca
ccatattttggagcttttgaaagagaaataagtgaattggagaaaaaacttacacaattg
tttattgtcttggacatttggatagatgttcaacgacaatggttatatttggaaggggtt
tttggaaacgaaaataatgacctcaaaagtttattaccaatagaaagttcaagattcact
aatatcagttatgagtttctaaacttattaaaaagaatttataaattcaatttggttatt
gatattgttctcattactgatcttcaacctatgatgacgaaatgttttgaaagcttggtg
aaagtaagaaaatcattgacagactaccttgaaaagcaaagagagttgttcccaaggttt
tactttattggtaatgaagatttattggaacttgttggcgggtcacatgatattaccagg
attaataatcacttgaagaaaatgtttagcggtgttgagaagttgcaatatgccaaggaa
agctcttgtattattggtgttgttagtgaacaaggtgaacaacttgtgttacacaatcca
gtttctttgataaagcataccagattacatgaatggctaagtgaattagaacttgagatt
aagttgactctttctcatttggttaaagacaatattaaagtttggcaagagagtgtattt
aaaaaagatggattggtacctttgattgacagtatcccagctcaagttgctacgttgtta
caacaagttacttttacaggcttaattgaggatccaactacactgctatcatcacttcat
gaaaacttgtctgataccattaaaactcttgttcgtgccattggttcagaaatagtggat
cttacaagaaagaaaacacaatatttgataatagaaataattcatcaaagagatgttgtt
gagcagttaatgaatgccgagagcgagtccgacagaaaattcattcgaagcattcaacag
aggttttactatgatatttctaacacagatttgctcaagagtttaactattaaacaagca
aattccgaatttgtatatgggtttgaatatttgggcattccagaaaaattggcctacaca
ccattaactaatgattgctatttagccatgtgtcaagctttgtctatacaacaaggaggt
tctcctttcggaccagcaggaactggtaaaacggaatcgattaaagccttaggtcacaat
ttagggaaaatggtgattgtgttttgttgtgatgattcatttgattttcagtctatggga
agaattttcttgggtttatgtaaagtgggtatttggggttgtttcgacgagtttaataga
ctagatgataaaatattaagtgctatatcatcccaaattgagagtattgaaaatggtttg
aaaaacccaaacatgactatatcagtgtctgaaaaaaatgttaaagtaaatccagaaaca
gggatttttataacaatgaatcctggctatgccggaagagtcgaattgccggaaaattta
aagaaaatgtttagaagcttttcaatggattcacctgataatgagattatagtggaaata
ttgctcacctcgcaaacatttgttaattccaaagccttggccaaatcaatcgttccattt
ttccaagagttggcttcaagcacttcaaaacaattgcattatgattttggcttgagagca
ttaaagaacacattggtgagatgtggccacgccaaaagaaaatctgccaatgccaatgaa
accttggcatttgaacaagaattagttgcccaaagtattgtggaaacaattttacccaaa
ttgattaaagaagatgaaattgtttttgaaaaattgagaaataaatactttgctaatgtt
gttggcaaagtacttgacaagtcaaaactaattacagcacttgaagagtactttacaaag
aatggagtccaattcgacgagaaatttgttaacaaggcattgcaattaattgacatccaa
aacacccatcatggtataatgctagtaggagaatcgggatctgggaaatctactatcctc
gatctgattatgtatgccttgtcagttgtaaccaatgtcgaacataccaaagtccttata
gatgccaaggttttgtctaaagatgaaatttatgggaagcttgatttggttacacgtgat
tggacggatggtttattcactagtgtattaagaaaaatgtcagaaaatttacgtggagag
ctctcaaggaaactttggatagtatttgatggagacattgatccgcaatgggccgaaaat
ttaaacagtgttttggatgacaataaaatattaactcttcccaatggtgagcgtttaagt
ttgccagaaaatgttcgtattgtttttgaggttgataacttggaatatactacaccagca
accattagtagatgtggaattgtctggtttgatgtatcgttgatctccttggatgcccat
ttacacaagttggttcatcaattgaacaaatttaaaataaccaacgatgacatgattggt
gacaacatgcttgctgacaatttgaaaatatcgtttgtggaggaattaaatcatttgctt
tctcacaatgttttgtctggtatctgtgaaattgccaaacaagttgaccacataatggag
ttctcattccaacgagctattggttctcttgaagtttacctaaagacctatttacgtcga
ttgttgagctttgctaattccaaggattacgaaacagtggaaatgaaaaaatacgtccaa
aaggctctattgctttcaataatgtggacatttgctggagattcttcgtatgagggtaga
attgaatttgcaaagaccataaaggacaagaaaatgttttggggagttgaaatgccaaat
gataatgtacttgattatgatatttccttacctgaaggtgaatggttggactggaacact
tttgttgcatcggtagaactcgaaccacatcaagtttcaaacccaaacacaattgtccct
actttagacacggtcaagcatgagcaattaatattttctgttttaaatgaacatagtcct
ttgttgctttgcggtccacctggttccgggaagactatgacgttatttgaagctttaaga
aaatctccacagttggaattattatcacttaacttttctaaagaaacttcaccagtgtcg
ttgttgaaggcattggatcaatattgtgagtatagaaaaacaaataggggcatccaatta
gctccacggattaatgggaagtgggtagttgtattttgtgatgaaattaatctaccacaa
gtcgacaagtatggaaatcaaaatgtcatttctttgataagacaaatggtagagcacggt
ggattttggcgagtcaaagataatcaatgggtttcattggaaaatatccaatttgttgct
gcttgtaactcgcccaatgatcctggtagaaacaaattatctgaacgatttttgcgtcat
gtcccagttattatggtcgattatccaggttatacttctttaacccaaatctaccaaaca
tttaatatggctattttgaaatgtgcccctgatttacgaggatttgccaaagctgtcact
gaagcaagtattcaagtatacgaaagaacaagaagaaagctaaacagtggaattcaaaag
cattatgtttattcacctcgtgaattaacgagatggagcaaaggtatacttgaagcttta
aaatcacacgtgtataaggatttgagtgctttccttagattgtggtatcatgaaggattg
agattgttttatgatagattggtgactgatgatgataaatcatggactttacaattattt
aaagaagtggccgaaaggaatttccccaacattaatttggatgctactttcaaagaaccg
gttttcttcagcaattggatgagtttgaattataaatctgtaaatgaacaagaactaaga
tcttttgtttccgaaaggctaagagttttcagtgaagaagaaatggaagtcgatttggta
ttgcatgatgaaatgctagatcatgctttacgtattgacagagttcttagacaaccacaa
ggtcacatgatattagtgggtcccagtgggagtgggaaatccactcttgccaagtttgtt
gcttggatcaatggattaaaagttgtgcaactacaagtgagaagtaattatggcattgac
gaatttgatgaagctttgcgaggtattttaacacgctgtgtgcacggtgaaaagatatgt
tttgttattgacgaatcaagtatcttggaagcatcatttattgaaagaatgaacacatta
ttagcaaatgctgaaattcctggtctttttgaaggtgaagattacacatcgttaatgagc
aaatgtttagaactatctcattctcaggggttgttactagacactgatactgagttgtac
gattggtttacccaacaaatctcgaaaaatttgcatgttgtgttcagcattagtgattcc
atcgagtctacaagccagtcagttatttcatcaccggcattatttaacagatgtgtttta
agctggatgggtgattggtctgataggtgcttgtatgaaattgcttcctcgcgtattagc
attgttcctcttgatatttcaaactacgttgtacctaacacttttaccccatttttatct
aatagaagggctaaaaatttgagagatgctattgttgatactttggcttttatccatcgg
tttatcccagaccataaatctacaatatcgtatagaagaacgccaaccgattttttgaat
cttgtacaaatgtttactgatttgtttagtatcaaacacaaagaattagaggattcacaa
cgacatatcactgttggtttggataaactacgtgaaactgttattcaagtggataaatta
caacgaatgctttcagaaaaggaaagtattttgaaaactaaagataaagaagccaaagaa
atgttgaacaaattactcacagatcaaaatgaagcagaacggaaacaagaattttcaatt
gccacacaggccgagctcgagaagcaagaaaaagaaattgagaaacggaaactggttgtt
atgaaagatcttgaatatgctgaaccagctgttcttgaagcacagagaggagtgcagaat
atcaaaaagcaacatttatccgaaattcgtagtatggccaatccaccagcagctgtgaaa
atgacaatggaatctgtttgtattttattgggctatgatgttggcacttggagagatgtt
caattggttattagaaaagatgattttataccaaatattgtttcgttcaatagcgaggaa
ctgttacccgttgagcttcgcaagtatatggaaagggtttacttgacaagagaagattac
acatttgaaattgttcatcgtgcaagtaaagcgtgtggtccattagtacagtgggttcaa
gcacaattggcgtattctagaattcttcaaagtgtaggaccactacgtgaagaagttgaa
ttgttggaacaaaaaacattgaagacaaaggcacaattgacagccattgatgagatgatt
tttgaattggaagaaagcattgaaaaatacaaggatagctacactgaattgattcgggaa
acagagaatataaaaactgaaatggcattagtgcataaaaaagtggatagaagcactacc
ttgattaaaaatcttaaagtggaaagagagagatggaaagaatctgtcaaattatttggt
gataaaagagacaaattagttggtgaggtgttgttggcggctgcttttattgtttatggt
gggctttatgatcagaaaggtagagagatattgttgaaaacatggagaaataaattaaaa
gagtctgggattccatttgatgaaacccatactatgtccagttatttggctacctcgaaa
aaagctttgcactggacaaattgtggattggttaatgataatattaatattgaaaacttt
gcattattggaatggtgtcaaaatccagttataatagatccaaatggtgtgattgtggac
atactatccaaagtgtcgtcaaagctggttacagttaccagtttcttaagtgatgggttg
ttgaaccagttggagaatgcattgaggtttggtggtttgataattatccaagattgtgag
tattatgatcctttattagacacagttttgagaaaagaaattcacagaaatggtggccga
atgatgattagattaggtgatcaaattattgattattcttctgaattcaaattgatatta
gcttcaaaggaatcggaattggttttacctccgtcagtagcttcaagagtgtcaattatc
aatttcacaattacaagtggtagtcttgaaaacagagctcttgatattgctttgaaagaa
acacgacccgatgttgaaaaagaaagaaccgatttggttatgcttaatggtgaatggaaa
ttacgtttgcagactttagaagaagagttattggattctcttagtaaaactccgggtgag
attttagataatgatagtgtgatgcaaactttggaaactcttaagaccgaaacagatggg
ttgaatgaaaaattggctcattcaggagaagttatgaaccgagttgaagagataagaaat
aattatagtgatgtggccaagaacttgtcaggaatatataccatctttgagtcacttggt
cgtcttaatcatttttacaggttttcattgacaagatttgttagtaattttgcacatcta
ttacgggagagcattaatttgtcaccatctgagtttattatggaattatacaaggattct
tttgcacacatttccacgtcattgcagtatcaacacaaaattgttttgtccttggttttg
tctactgcttattacatggaggatattggtgatctgtacaagactgcatttatgaaaaca
ttaaagttgattgttactgaaaaattaccaaatagtgttaatgaggtgtttgatgtgtgt
ttagcaaggagagaatcaggatgggatgttgaaaaagtattagagatgaatcaagacaat
ctggttttgcaaatgctttcggatttgcttttaagtttcaacaatacaagaaatagtgag
gattttgttgatacttttagtaagatcagtgggtttttgtttaaagatggagaagctcca
tactcatctccatataatttggattattggataaatgaattgggaattagaactattata
ttgacatgtccagaagtttatgatgcctcatacaaggttgaacaaagtgctcgacaattt
aacaagaaattatctgttatttcaatggggacaaaagaagggattgagatggccaataaa
gaaattgaagctgcttctatgtctggacgttgggttttgattcaaaacatccacatggcg
ccatcatggatatcacattttgaaaatcaactcactaatctacatgcagaatcaaaaata
tttttgacatgtaaaaacgattctcaagttccaattggggttatatctcaatgtaaagta
ttgaattttgaaaatgaagtggggattcaacgaattgtgttggatacctataaatccagt
tctatggagaaaagagaaagaattgaacgacatgttttattgcttttgatttggtaccat
tcagtcattcttgaaagagtgagatactcaccggtatcgtttaagaagaaatatgatttc
aatgattccgattattcctgtggtgtacatattatcgaaaaagtatttgaaagttacgat
ggtaaaactgaaaccattccttggaatgagatcaaatatttaattgcaaccataacttat
ggtggtaaagttgatgataaagaggatttggcatttttggagacttttgctagtgatatt
ttcacagaaagatcttttgatcaaaatttcaatttgatagataatgaatttactaaagaa
agcaatgaagttttgccgttgcccgacactacagaagaaattgaattatggatcaataag
ttgccatatgagacaccattatcatggatttatttgcctgaagatgctaatctgttagtg
aaaaaacaacttggattagaggttgtggaatctgtacttgatttatctgaagttttatag

DBGET integrated database retrieval system