KEGG   Candida dubliniensis: CD36_85280Help
Entry
CD36_85280        CDS       T01140                                 

Definition
choline kinase, putative (EC:2.7.1.32)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cdu  Candida dubliniensis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CD36_85280
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CD36_85280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1218282..1220006)
Genome map
AA seq 574 aa AA seqDB search
MMEISPANIKEQSQSRSRSRSRTRNSTANSRSTSATRRPSLSSSRRRSLSSSSLNRLTIT
TTQVDQERSVPSVHVYLDNSLPLDFFKQDIIALTKTLKISKWHKRQLTINNLNINRISGA
LTNAIYKIEYHDDLQNIHLPTLLLRVYGKNVDELIDRDNELAILIKLSQKRIGPRLLGIF
SNGRFEQFLDGFLTLNKQQIRDEILSQMLGRRMKDLHYKIELDTKDYESTQPTCWNLIDK
WLKLFEQELLPGYLQANYNLQDIFIVSFDQFKNIINKYKQWLFNKYDEKNFTNNYKFCHN
DTQYGNLLLHESFNPQDILVSTSSSDTNNNIVDGEVTIKSTSNKKDTNLVVIDFEYSGAN
FPAYDIVNHFSEWMSDYHDPEKSYFIHQENYPNQLQQINLIKSYIEYDFQYPSSNLKTGQ
TPESLINNSTNPISIIQYEIEKLYNECIYWRATVQIFWCLWGLIQNGPLKKPINSNALSE
QGINSTYNITIGDMENLEITDHNKEKQGSNINDGVIEEEAITSSDDDFDYLKYSNQKVAL
IFGDLIQFGIIDEKDVDEKYLSLIKYLDTKTFDI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgatggagatatcaccagctaatattaaagaacaatcacaatcacgatcaagatcaaga
tcaagaactagaaattctacagcaaattctcgatcaactagtgccacaagaagacctagt
ttatcttctagtcgtagaagatcattatcttcatcttcattaaatagattaactataact
actacccaggttgatcaagaaagatctgttccttcagtccatgtttatttagataattcc
ttaccattagatttttttaaacaagatattattgccttaactaaaactttgaaaattagt
aaatggcataaacgtcaattaaccattaataatttgaatattaatagaatttcaggggca
ttaactaatgctatatataagattgaatatcatgatgatttacaaaatattcatttacca
acattattattacgagtttatggtaaaaatgttgatgaattaattgatagagataatgaa
ttagccattttaattaaattatctcaaaaaagaattggaccaagattattaggaatattc
agtaatggtagatttgaacaatttttagatggatttcttacattaaataaacaacaaatt
agagatgaaattctttcacaaatgttgggtagaagaatgaaagatttacattataaaatt
gaattagatactaaagattatgaatcaactcaaccaacatgttggaatttaattgataaa
tggttaaaactttttgagcaagaattattaccaggatatttacaagctaattataatctt
caagatatatttattgtttcatttgatcaattcaaaaatattatcaacaaatataaacaa
tggttatttaataaatatgatgaaaaaaatttcactaataattataaattttgtcataat
gatactcaatatggaaatttattattacatgaatcatttaatcctcaagatatacttgtc
tcaacatcatcatcagatactaataacaatatcgttgatggtgaagttactattaaatca
acttctaataaaaaagacactaatttagtagttattgattttgaatattctggagctaat
ttccctgcttatgatattgttaatcatttttcagaatggatgtctgattatcatgatcct
gaaaaatcttatttcattcatcaagaaaattatcctaatcaattacaacaaattaattta
attaaatcatatattgaatatgatttccaatatccttcatcaaatttgaaaactggacaa
actccagaaagtttaattaataattctactaatccaatatcaattattcaatatgaaatt
gaaaaattatataatgaatgtatttattggagagctacggtacaaattttttggtgtctt
tgggggttaattcaaaatggtccattaaaaaaaccaattaattctaatgcattatcagaa
caaggtattaattcaacttataatattactattggtgatatggaaaatttagaaataact
gatcataataaagaaaaacaaggttctaatatcaatgatggtgtaattgaagaagaagca
attacttctagtgacgatgattttgattatttgaaatattctaatcaaaaagtagcatta
atatttggtgatttaattcaatttggaattattgatgaaaaagatgtggatgaaaaatat
ttatctttaattaaatatcttgatactaagacttttgatatttaa

DBGET integrated database retrieval system