KEGG   Candida dubliniensis: CD36_85670Help
Entry
CD36_85670        CDS       T01140                                 

Definition
ceramide synthase component, putative
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cdu  Candida dubliniensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CD36_85670
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CD36_85670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1329817..1331145)
Genome map
AA seq 442 aa AA seqDB search
MSSGSITTTKISSATIPNRPISIESIEDHQYHNSFLAMVERNQIPLSRSLLIVLYLAHLL
NHNTITPYTSKFIHIQNCVGIDEVNGKSIYDIDINDVYFVIHSLVIVTFLRSFLMKWCFE
PFASIFCHIHSKKAKTRFAEQSWSFVYYSISFIYGVILYLDSPYYNNLDQVYINWPNHYM
SWEFKTYYLVSMGFWLQQIFVLNVEKPRKDHYQMFSHHIITCLLIIGSYYYYYFRIGHLI
LMIMDSVDIFLAAAKMLKYAGFSNACDAMFLLFLVSWIVLRHGVYNYIFYHAWYKSVDLM
KNGQCVEGLNQKRCWTPVVIDAFLGLLGGLQIITCIWMYLILKVAYKVVTGSGAEDVRSD
EDDTDIEIDNENDVDDIEVDIEVEEEEEEELEEIQQPIILEKKEEEVVLEIEEDKYSFER
DSFSSSSESTLDEKKDIRKRKA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggatcaatcacaactacgaaaatctcactggcaacaatacccaatagacca
atttctattgaatcaatagaagatcatcaatatcacaattcattcttagcaatggttgaa
agaaatcaaataccgttatcaagaagtctattaattgttttatacttggcacatttattg
aaccataacactatcactccatatacatctaaatttatacatattcaaaattgtgttggt
attgatgaagttaatgggaaatcaatatatgatattgatattaatgatgtatattttgtt
attcattcattagtaattgttacatttcttcgttcatttttaatgaaatggtgttttgaa
ccatttgcatctatattttgtcatattcattctaaaaaagccaaaacaagatttgctgaa
caaagttggtcatttgtttattattcaatttcatttatttatggagtaatattatattta
gatagtccttattataataatttagatcaagtttatatcaattggccaaatcattacatg
tcttgggaatttaaaacttattatttggtaagtatggggttttggctacaacaaattttt
gttttaaatgttgaaaaaccaagaaaagatcattatcaaatgtttagtcatcatattatt
acttgtttattgattattggttcgtattattattattatttccgtattggtcatttgata
ttgatgattatggattcagtagacatttttttggcagcagcaaaaatgttgaaatatgct
gggtttagtaatgcttgtgatgccatgtttcttttatttttagtcagttggattgtatta
agacatggtgtatataattatatcttttatcatgcttggtataaatcagtggatttgatg
aaaaatggacaatgtgttgaaggattgaatcaaaaaagatgttggaccccagttgttatt
gatgcatttttgggtttattaggagggttacaaattataacttgtatttggatgtatttg
atattaaaagttgcttataaagttgtaactggatcaggtgctgaagatgttagaagtgat
gaagatgacactgatattgaaattgataatgaaaatgatgttgatgatatcgaggtggat
attgaggtggaagaggaagaggaagaggaactagaagaaattcaacaaccaataattttg
gaaaaaaaggaggaagaagtagtattagaaatcgaagaagataaatactcttttgaaaga
gattcatttagttcgtcatcagaatctactttggatgagaaaaaggatattaggaaaagg
aaagcataa

DBGET integrated database retrieval system