KEGG   Candida dubliniensis: CD36_85990Help
Entry
CD36_85990        CDS       T01140                                 

Definition
Elongator complex subunit, putative (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CD36_85990
Transfer RNA biogenesis [BR:cdu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CD36_85990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1420710..1422353
Genome map
AA seq 547 aa AA seqDB search
MPVQKNKVPEKERFIQCCGDISLELVASLKSSKDINLNGLITRYAKKYKLKQQPRLTDII
SSIPDQHKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFE
YSTQSYTGYEPTSMRAIRARYDPYEQARGRVDQLRQLGHSIDKVEYIIMGGTFMSLPIDY
RENFITQLHNALTGFNGNNIDEAIEFSQQSQTKCVGITIETRPDYCTETQLSDMLKYGCT
RLEIGVQSVYEDVARDTNRGHTVKAVCETFAVAKDAGYKVVSHMMPDLPNVGMERDLEQF
KEYFENPEFRTDGLKLYPTLVIRGTGLYELWKQGLYKSYNANALIDLVARIMALVPPWTR
IYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTREVGIQEVHHKVVPDQVE
LIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFVSQPTSIVRELHVYG
SVVPLHSRDPRKFQHQGFGTLLMEEAARIAKEEHGSEKISVISGVGVRNYYAKLGYELDG
PYMSKML
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccagttcagaagaataaagttccagaaaaggagagatttatacaatgttgcggagac
atatctttggaattagttgcatcactaaagagttccaaagacatcaatttgaatggtttg
ataactcgatatgccaaaaagtataaattgaaacaacaaccaagattaaccgacatcata
tcttccatacctgatcaacataagaaatatttgattccaaaactaaaggcaaaaccagtt
agaacagcgtcaggaattgctgttgttgctgttatgtgtaaaccacacagatgtccacac
attgcatacacagggaatatttgtgtttattgtcctggtggtcctgattctgattttgaa
tatagtacacaatcttatactggttacgaaccaacctctatgcgtgccatcagagcaagg
tatgacccgtatgaacaggcaagaggtagagttgaccaattaagacaattgggtcattct
atagataaagttgaatatatcattatgggaggtacattcatgtcgttgcctattgactat
agagaaaattttataacgcaattacacaatgccttgactgggttcaatgggaataatatt
gatgaagctattgagtttagccaacagctgcaaactaaatgtgttggtattactattgaa
actagaccagattattgtacggaaactcaattgagtgacatgttgaaatatggttgtacc
aggttagaaattggggttcaatcggtttatgaagacgttgctagagatactaatcgtgga
cacacggttaaagcagtttgtgaaacatttgctgtggctaaagatgctggttataaggtt
gtttcgcatatgatgcctgatttacccaatgttggaatggaaagagatttagaacaattt
aaagaatattttgaaaaccctgaatttagaactgatggtttgaaactatatccaacatta
gttattcgaggcactggtctatatgaattgtggaaacaagggttgtacaagtcttataat
gctaatgctttgatcgatttagtggcccgtataatggcacttgttcccccatggacccgt
atttatcgtgttcaaagagatattcctatgccattggtgacttctggggttgaaaacggt
aatttgcgtgaattagctcttgccagaatgaaagattttggtacctcatgtagggatgtg
cgtacaagagaagtaggtattcaagaagttcatcataaagttgttcctgaccaagttgaa
ttaattagacgtgattactatgcaaatggaggttgggaaacatttttaagttatgaagat
ccaaagcaagatattttaattgggttattaagattgagaaaagcaagcaaaaaatacact
tatcgtaaagagtttgtttctcaaccaacatcgattgttagagaattgcatgtgtatgga
tcagttgtacccttgcattccagagatccaagaaaatttcaacatcaagggtttggtaca
ttattgatggaagaagcagcaagaatagctaaagaagaacacggctcagagaaaataagt
gtgatttcaggggtcggggttagaaattattatgccaaattaggttacgaattggatggt
ccttacatgtcaaagatgttgtaa

DBGET integrated database retrieval system