KEGG   Candida dubliniensis: CD36_86850Help
Entry
CD36_86850        CDS       T01140                                 

Definition
dolichyl-phosphate-D-mannose:protein O-D-mannosyltransferase, putative (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cdu  Candida dubliniensis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cdu00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1639331..1641634
Genome map
AA seq 767 aa AA seqDB search
MSTSVEPNETEALLRKQNELSTTASIEEKYPNHQEDEDEVDTLKRTQYDEAKETAESLKQ
VESILAPILFTALSFFVRFYRISVNDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV
GLSGYLAGYNGSWDFPSGEKYPDYIDYTKMRLFNATFSALCVPLAYFTGKEIGFSMFTTW
LFTLMVALESSYVTLGKFILLDSMLLFFTVATVFCFSRFNNFNNKSQEFSRKWWKWILLT
GVSIGCTCSVKMVGLFVTTLVGIYTVVDLWNKLSDKSISWTKYIQHWFARIVALIIVPIF
IFMLSFKVHFDLLYKSGTGDANMSSLFQANLAGSDVGGGPREVSMFHSVITLKNQGLSGG
LLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNTTDVEYIFDGMHVR
LMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWIVEIMEQASDEDKMRLHPL
TSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWWNIENNRNAILPPA
PEDFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQWPTLNVGIRMCGWGP
ENPKYYMIGSPATTWTSTFGVILFAFIVLYYLIRWQRQYVDFPSTNPHKLKLFVMGGIYP
MFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFASRLNTPNASPVSKLLYLA
IYISLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSDDQYT
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttctgttgaacccaatgaaacagaagctttgttgagaaagcagaatgaactt
tctacaactgcttcaattgaagaaaaataccctaatcaccaagaagatgaagatgaagtc
gatactcttaaacgaacccaatatgatgaagctaaagaaactgctgaatctttaaaacaa
gttgaatccattttggcacctattcttttcactgcattgtcatttttcgtgagattttat
cgtatttcagtgaatgatcatgttgtttgggatgaagctcattttggtaaatttggatcc
tattatttacgacacgaattttatcatgatgttcatcctccattgggtaagatgttagtt
ggtttatctggttatttggcagggtacaatggatcttgggatttcccaagtggtgaaaaa
tatccagattatattgattatactaaaatgagattgtttaatgccactttttctgccttg
tgtgttccattggcatatttcacagggaaagaaattggattttctatgtttactacttgg
ttattcactttaatggtggctcttgaatcaagttatgttacattaggtaaattcatttta
ttggattcaatgttgttatttttcactgttgctactgttttctgtttttctcgtttcaac
aattttaacaataaatcacaagaattttccagaaaatggtggaaatggattcttttaacg
ggtgtttccattggttgtacttgttcagttaaaatggttggattatttgttaccactttg
gtgggtatttacactgttgtcgatctttggaacaaattgagtgataaatctatttcatgg
acaaaatatattcaacattggtttgctagaattgttgccttgattattgtccctattttc
atctttatgctttcatttaaagttcattttgatttgttatataaatcaggtaccggtgat
gccaatatgtcatcacttttccaagctaatttggctggttccgatgttggtggtggtcct
cgtgaagtatctatgttccactcagttattactttaaagaaccaaggtttaagtggtgga
cttttgcattcacatgttcaaacattcccagaaggttccaaacaacaacaagttactact
tatggtcataaagattcaaacaacaattggattttccaaagagctagaggacaaccttat
tatgacacttcaggtaacactactgatgttgaatatatttttgatggtatgcatgtaaga
ttaatgcatccacaaactggtagaaacttacatactcatgacattcctgcaccagtctct
aaatctgaatatgaagttgcatgttatggtaatttaactattggtgatcctaaagataat
tggattgtggaaattatggaacaagcaagtgatgaagataagatgagattacatcctttg
acttcatcatttagattgaagaatgaagtgatgaattgttatttgggagttactggtact
actttacctcaatgggggtttagacaaggtgaagttgtttgttataaaaacccatttaaa
aaagacaaaagaacttggtggaatattgaaaataatcgtaatgcaattttaccaccagct
ccagaagatttcaaattacctaaaaccaaattcatccgcgatttcattcaattgaatttg
gctatgatggctactaataatgctttagttcccgacactgaaaagcaagatgatttggct
tcatcattttggcaatggccaacattaaatgttgggatcagaatgtgtggatggggacca
gaaaatcctaaatattatatgattggttcaccagcaactacttggacatctacttttggt
gttattttgtttgcatttattgttttgtattatttgattagatggcaaagacaatatgtt
gatttcccaagtactaatccacacaaattgaaattatttgtcatgggaggtatttatcca
atgtttggttgggggttacatttcttaccatttgccattatgggtagagttacctatgtt
catcattatgttcctgcactttattttgccatgcttgttttctgttatgaagttgaatca
tttgcttcaagattaaatacacctaatgcttctccagtgctgaaattattatatttggcc
atttatatcagtttgctttccttagttgctggtactttctggtatttcagatatttatct
tggggtatggaaggaccaaaagaagattggaagcatttgaaattattggaatcatggaga
gtctctgatgatcagtatacctag

DBGET integrated database retrieval system