KEGG   Candida dubliniensis: CD36_86930Help
Entry
CD36_86930        CDS       T01140                                 

Definition
histone deacetylase, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CD36_86930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1663796..1665523
Genome map
AA seq 575 aa AA seqDB search
MYTELPFDELKVDPTQKKRIAYFYDADIGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFISRVNPDNLDLFTKEQIKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGKGKYHAVNVPLRDG
IDDATYKSIFEPVISKIIEWYQPSAIVLQCGGDSLSGDRLGCFNLSMNGHANCINFVKSF
NIPMMVVGGGGYTMRNVARTWAYESGLLNNVKLPDELPYNEYYEYYGPDYKLDVRSSNMF
NQNSPEFLDKILTNIIANLENTKHAPSVQMNEVPNDPEDLGDIEEDTAMAIDTKGGSEMS
RDAQIQPDNEFYEDDEKDKGEKAIVDNKQEEQDSMNIDKNETPVVEKNKEIVEDKQQDEN
ENTDDKIEEDKPEETNPVEEKAPEEKVEEVKPVEEKAEEVKEVEEKVEELKEVDKPEVTP
TEPTKESKQEDQPMEDATKLTEEELKEIEELNKGS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtatactgaactcccatttgatgaattaaaagttgatccaactcaaaagaaacgtatt
gcttatttctatgatgctgatattgggaattatgcttatggtgctggtcatcccatgaaa
cctcatcgtataagaatggctcattcattaattatgaattatggattatataaaaaaatg
gaaatttatcgagccaaaccagcaacaaaacaagaaatgtgtcaatttcatactgatgaa
tatattgattttattagtcgagttaaccctgataatttagatttatttactaaagaacaa
attaaatttaatgttggtgatgattgtccagttttcgatggattatttgaatattgtggt
attagtggtggtggttcaatggaaggagcagcaagattgaatcgaggtaaatgtgatatt
gccattaattatgctggtggattacatcatgcaaaaaaatctgaagctagtgggttttgt
tatttaaatgatattgtattgggaatcattgaattattacgataccatccaagagtatta
tatattgatattgatgttcatcatggtgatggtgtcgaagaagcattttatactactgat
agagtaatgacttgttctttccataaatacggagagtttttccctggaactggtgaatta
agagatattggagtaggtaaggggaaatatcatgctgttaatgttccattacgtgatggt
attgatgatgccacctataaatcaatatttgaaccagtaatatcgaaaatcatcgaatgg
tatcaaccttcagccattgttttacaatgtggaggagattccttgagtggtgatcgatta
ggttgttttaatttatctatgaatggtcatgctaactgtatcaattttgttaaatctttt
aacatacccatgatggtagttggtggaggtggttatactatgagaaacgtggctcgtact
tgggcttatgaactgggattattgaacaatgtcaaattacccgatgaattaccttataat
gaatattatgaatattatggccctgattataaattggatgttcgatcatctaatatgttt
aatcagaattctccagaatttttagataaaattttgacaaacattattgccaatttggaa
aatacaaaacacgcgccttcagtacaaatgaatgaagttcctaatgatccagaagattta
ggagatattgaagaagatacagccatggcaattgatacaaaaggaggttcagaaatgagt
cgagatgctcaaatacaaccagacaatgagttttatgaagatgatgagaaagataagggg
gagaaagctatagttgataataaacaagaagagcaagattcaatgaatattgataagaat
gaaacacccgttgttgagaagaataaagagatagtagaagataaacaacaagatgaaaat
gagaatacagacgataagatagaagaggataaaccagaagaaacaaacccggttgaagaa
aaagctccagaggaaaaagtagaagaagtaaaaccagttgaagagaaagcagaagaagta
aaagaggttgaagagaaagtagaagagttaaaagaggttgataagccagaggtaactcca
acagagccaaccaaggaactgaaacaagaggatcaacccatggaagatgccacaaaatta
actgaagaagaattaaaagaaattgaagaactaaataaaggttcataa

DBGET integrated database retrieval system