KEGG   Corynebacterium diphtheriae VA01: CDVA01_0282Help
Entry
CDVA01_0282       CDS       T01702                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00010  Glycolysis / Gluconeogenesis
cdv00260  Glycine, serine and threonine metabolism
cdv00680  Methane metabolism
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01120  Microbial metabolism in diverse environments
cdv01130  Biosynthesis of antibiotics
cdv01200  Carbon metabolism
cdv01230  Biosynthesis of amino acids
Module
cdv_M00002  Glycolysis, core module involving three-carbon compounds
cdv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDVA01_0282 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDVA01_0282 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDVA01_0282 (gpmA)
Enzymes [BR:cdv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDVA01_0282 (gpmA)
Membrane trafficking [BR:cdv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CDVA01_0282 (gpmA)
Exosome [BR:cdv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDVA01_0282 (gpmA)
  Exosomal proteins of melanoma cells
   CDVA01_0282 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX82551
Position
300531..301277
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
caattcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtttacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccattggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaacaag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttat
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtgcagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system