KEGG   Corynebacterium diphtheriae VA01: CDVA01_0297Help
Entry
CDVA01_0297       CDS       T01702                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312733..313725
Genome map
AA seq 330 aa AA seqDB search
MNLDLIRRPRRLRSTPVMREFVAETTLRPADLILPMFIADGIDKPREIESMPGVCQHTME
SLIEAVREAISVGIRCVDLFGVPLDSDKDATGSQAWDPEGILNRGVRALRQEFGDQVLIM
ADTCLDEFTDHGHCGILTTDRFGATIVDNDPTVELYQKMAVAQAEAGAHIVSPSGMMDGQ
ILAIREALDAAGFHDVAIMAYSAKYASAFYGPFRDAVGSSLQGDRRAYQQDPANLRESIL
EVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAAYQVSGEYAMLHAAAANGWLDLD
RVTMESLISIKRAGADQILTYFAVEAARKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatctagatcttattcgtcgtcctcgtcggttgcgttcgactccggtgatgcgtgaa
ttcgttgcggaaaccacgctgcgtccggctgatcttattttgccgatgtttattgccgat
ggcattgataagcctcgggagattgagtcgatgccaggtgtgtgccagcacaccatggaa
tcccttatagaggctgtccgtgaggcgatctcggtgggtattcgctgcgtggatcttttc
ggtgtgccactggattccgataaggatgccactgggtcacaagcgtgggatcccgagggc
attttgaaccgcggtgtgcgtgcgcttcgtcaggagttcggtgatcaggtgctcatcatg
gcggatacctgccttgacgagttcaccgatcatgggcactgtggcattttgaccacggat
cgctttggcgccaccattgtggataacgatccaacggttgagttgtatcagaagatggcg
gttgctcaggctgaagcgggtgctcatattgtgagcccgtcgggcatgatggacggccag
attttagctatccgtgaggctctcgacgccgcagggttccacgatgttgcgatcatggcg
tattccgctaaatatgcgtcggcgttttatggtcctttccgtgacgcagtgggctcctct
ttgcagggtgatcgtcgtgcctaccagcaagatcctgctaatctccgtgagtcgatcctc
gaagtcgatctggacatcgaggaaggcgcggattttgttatggtcaaacctgctatgccg
tacttggatgtgcttgctgaggtagcgtctacgtcgtcggttccggtggcggcttaccag
gtttctggcgagtatgcgatgttgcatgcggctgctgcgaacggctggttggatctggat
cgggtgacgatggagtctctgatttctattaaacgtgccggtgcggatcaaatcctgaca
tactttgctgtagaagcagcacgaaaactttaa

DBGET integrated database retrieval system