KEGG   Corynebacterium diphtheriae VA01: CDVA01_0755Help
Entry
CDVA01_0755       CDS       T01702                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cdv00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791243..792178
Genome map
AA seq 311 aa AA seqDB search
MTSYAITAVASSKVNLHLGVGNVRDDGYHELVTVFQSLSLHDTITVTPAADDMHDAEDQG
IVATLSVSGDSAQAVPTDATNLAWQAAEKMYQAHRRNGGAPAKRVHIAIDKGIPVAGGMA
GGSADAAATLAAMAQYLGNTVTEQEILSIAAQLGSDVPFTYLGDTRLGTGRGEQLVPVLS
RGTYHWALAFSAQGLSTPEVFRKIDQMDRQPHLDVTALNAALITGDPHKVAAHLHNDLQA
AALSLRPELRTTLEQGRAAGALAGIVSGSGPTCAFLCEDAETAQAVAAELSVHYRTAVAT
GPVRGAHVKGH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttacgccatcacagcggtcgcctcgtcaaaagtcaaccttcatcttggagtc
ggcaacgtgcgtgacgacggctaccacgaactcgtcaccgtatttcaatcactgagcctg
cacgacaccatcacggtgacaccagccgcagatgatatgcacgatgccgaggaccaagga
atcgtcgcaacgctgagcgtgagcggcgacagtgcccaagccgtgcctaccgacgccacc
aacctcgcatggcaggcagccgagaaaatgtatcaggcacatcgtcgcaatggtggagcc
cccgccaagcgcgtgcacatcgccatcgacaaagggattccggtcgcaggcggaatggcc
ggtggatcggccgatgccgctgccacgttagcagccatggcacagtacttgggcaacacc
gtcaccgagcaagaaatcttgagcattgcagctcagctgggctccgacgtgccctttacc
tacctcggtgatactcggctaggaacaggccgcggtgaacaactcgtcccagtcttatcg
cggggaacctaccattgggcactggcgttttctgcgcaaggcctatctacacccgaggta
ttccgcaaaatcgatcagatggaccgccaaccgcatctcgatgtcaccgcgctgaacgca
gcgctgattacgggagatccccataaagtagcagcgcatttgcacaatgatctccaagca
gcagcgctttcactacgccccgaattacgcaccaccctagagcaaggtcgtgccgctgga
gcactggccggaatcgtatcgggatccggacccacctgcgccttcctttgcgaagatgcc
gaaactgcccaagcagtagccgcggaactaagcgtgcactaccgaaccgctgtcgctacc
ggacctgtccgcggcgcccatgtgaaaggacactag

DBGET integrated database retrieval system