KEGG   Corynebacterium diphtheriae VA01: CDVA01_0961Help
Entry
CDVA01_0961       CDS       T01702                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDVA01_0961 (pfkA)
   01230 Biosynthesis of amino acids
    CDVA01_0961 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDVA01_0961 (pfkA)
   00030 Pentose phosphate pathway
    CDVA01_0961 (pfkA)
   00051 Fructose and mannose metabolism
    CDVA01_0961 (pfkA)
   00052 Galactose metabolism
    CDVA01_0961 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CDVA01_0961 (pfkA)
Enzymes [BR:cdv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDVA01_0961 (pfkA)
Protein phosphatases and associated proteins [BR:cdv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CDVA01_0961 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010408..1011436
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYQDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKSGLDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDIAEICKAMERRFQMGEKYGIIVVAEGALPKEGTMDFVEGGVDQ
FGHQTFNGIGQVIGEEIKKRLGHDVRTTVLGHIQRGGTPTSYDRVLATRYGVHAARACHN
GDYGKMVALHGEHIDLIPLEDAVDTLKTVPEGRYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactcttacatccggcggcgattgccccggcctcaacgctgtgatccgc
ggcattgtccgcacatgttctgagtacggctcgaccgtcgttggataccaagacggctgg
gtggggctcatggaagacaagcgcattcaactatatgacgatgaaaacatcgatcgtatc
ctgttgcgcggcggaaccattttgggtaccggccgccttcaccctgacaagtttaagtct
ggtcttgaccagattaaggcaaaccttgaggatgcaggtattgatgcactgattcctatc
ggtggcgaaggtacgctcaagggtgccaaatggctatctgataatggtattcctgtagtt
ggcgtgcctaagacgatcgacaacgacgttaacggtacggattacacttttggctttgat
accgcagtctctgttgctacggatgctatcgaccgactgcacaccacagctgagtctcac
aaccgtgtgatgatcgttgaggttatgggtcgtcacgttggctggattgcgctgcacgcc
ggcatggcaggcggtgcgcattacacagtcattcctgagcagccatttgatattgcagag
atctgcaaggcaatggaacgtcgcttccagatgggtgaaaagtacggcattattgtcgtg
gcggaaggtgcattgcctaaggaaggcacgatggactttgtcgagggcggcgtcgaccaa
tttggccaccaaacgtttaatggcattggtcaagtaattggtgaggaaatcaagaagcgc
ctcggtcatgacgttcgtaccacggttttgggtcatatccagcgtggtggcacacctact
tcttatgaccgcgttttggctacccgttacggtgttcacgccgcacgtgcgtgccataac
ggtgattacggcaagatggttgcgttgcacggtgaacatatcgatctgattccgctcgag
gacgcggtagatacgctaaagactgtccctgaaggacgttaccgcacagcacgcgccctg
tttggctaa

DBGET integrated database retrieval system