KEGG   Corynebacterium diphtheriae VA01: CDVA01_1038Help
Entry
CDVA01_1038       CDS       T01702                                 

Gene name
pheT
Definition
phenylalanyl-tRNA synthetase subunit beta
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cdv00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095451..1097961
Genome map
AA seq 836 aa AA seqDB search
MLISQNWVTELLGRSNPDWKVSPAELDSGYVRVGFETEGYSAIPETTGPLVIGRVETIEE
LEGFKKPIRHCFVNVGDANGTGELQSIVCGARNFQEGSYVVVSLPGAVLPGNFAISARET
YGRMSAGMICSAAELGLSDKQNPGIITLPNEIAEPGTDARSIVGLDDTVFDVNITPDRGY
ALSARGLTRELASAFNLKFVDPAVDLNVAGVDTSDVPEPSGELIKVDLRPETQARRFGVR
KISGIDPKAPTPFWMQRELMLSGQRCVNAATDVTNFVMLLLGQPMHAFDANLIKGGLVVR
NALEGESFETLDHVKRTLSAEDVVISDDAGIQSLAGVMGGTTSEISDETIDVFFEAANWH
PITTARTSRRHKLSTEASRRFERGVDPEIIEVALDVACALLVSIAGGSVESARTLIGSAP
SMPQIRMKTSRPAELAGVAYSDATVIARLKEVGCAVEVDGDDLLVTPPTWRPDMTMSADL
VEEVLRLEGLEDIPAIVPLAPVGSGLSPAQLRRRAIGHALAYSGYAEILPTPFIRNDTFD
VWGLAADDERRSVVTVQNPLDAEYGVLATTLLPSMLEAVTRNVARGQTSVNLFGLQQVSF
KRGSGISPMLDVRQRPSDNEVAELLKSLPVQPLHVATVGAGFMELDGPWGHGRTYSFADA
IESARVVARAAGVELNVENVEMLPWHPGRCAALKAGDHIVGYAGELHPQIVEALNLPART
CAMELDVSALPLKESFPAPVLSAFPVLHQDLALVVDESVPAESVRKVIEDAAGELLEKVE
LFDVYRSEALGAEKKSLAFSLEFRAQDRTLTDDECSEGRLAAAGRAAELFGATMRA
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgctcatttcacaaaactgggtcaccgaattgttaggtcgatcgaacccagattggaaa
gttagcccagctgagctggattcgggatatgtccgagttggatttgaaaccgagggttac
agcgcaatccctgaaacgactggtccactcgtcatcggtcgagttgaaacaattgaagag
ctagagggctttaaaaagccaattcgtcactgcttcgtcaatgttggagacgcgaatggc
actggagagcttcagtccattgtatgcggggcgcgtaatttccaagaaggttcttatgta
gtagtttcacttccaggtgctgttttgcctggtaatttcgcaatttcggcacgtgagaca
tatggacgcatgtcagctggcatgatttgctcggcagcggaattggggctatctgacaag
caaaatcctggaatcataacgcttccgaatgaaatcgccgaaccaggaactgatgcacga
agcattgttggtttggacgatactgtttttgatgtcaatatcacgccagatcgtggatat
gcattgtctgcacgtggattaactcgagaactggcttcggcttttaatctaaagttcgtt
gatcctgcagtagatcttaacgtggctggcgtcgatacttcggatgttccagagccttca
ggtgagttaattaaggttgatctgcgaccagaaacgcaggcacgtcgtttcggagttcgt
aaaatttctggaatcgatccaaaggctcccacaccattttggatgcagcgtgagctcatg
ttgtcaggccagcgttgcgtgaatgccgcaactgacgtgaccaatttcgtcatgttgctt
ttggggcagcctatgcatgcctttgatgccaacttaattaagggcggattggttgtacgt
aatgccctagaaggggagtcttttgagactcttgatcatgtaaagcgtactttgtctgca
gaagacgttgttatctccgatgatgctggtattcaatccttggctggcgttatgggcgga
actacttcagaaatctcagacgaaacaattgatgtattttttgaagctgccaattggcat
ccaattactacagcacgtacgtcgcgtcgccataagctcagcaccgaggcgtcacgacgc
ttcgagcgtggcgttgacccagaaattattgaggtagctctggacgttgcctgcgcctta
cttgtcagtattgctggtggttctgtggaatccgcccgcactttgattggatctgcgcca
agcatgcctcaaatccgtatgaagacgtctcgcccagccgagttggctggagtagcttac
tcggacgctactgtgattgcgcggttgaaagaagtcggatgtgctgtcgaagtcgatggt
gatgatcttcttgtcacgcctcctacgtggcgtccagatatgactatgtctgctgatttg
gttgaagaagttcttcgtctcgaaggattagaggacattccagcaatcgttccgcttgca
cctgtgggatcagggctctcgcctgcgcaattgcgtcgtcgtgcgatcggtcatgcactt
gcatacagtggctatgcggaaatcctacctacgccttttattcgaaacgatacgttcgat
gtgtgggggcttgcagcagacgatgagcgtcgaagcgtcgtcacggtacaaaaccctctc
gatgctgagtacggagttctcgcgactacattgctgccttctatgctcgaggctgttacc
cgcaatgttgctcgagggcaaacttctgtcaatcttttcggtcttcagcaggtatccttc
aaacgtggctcaggtatttcgccaatgctcgatgtccgtcagcgtcctagcgataatgaa
gttgctgagttgctaaaatccttgccagtacaaccactccatgtggcaactgttggtgct
ggttttatggagttagacggaccatggggccatggtcgaacgtattcgtttgctgatgct
atcgagtcggctcgagttgttgcccgtgcagcaggcgttgaacttaacgtcgaaaatgta
gagatgctaccttggcatcctgggcgctgtgctgcattaaaagctggtgaccacattgtt
ggatatgctggcgaattgcatcctcagattgttgaagccttgaatctgccagcacgtacg
tgcgccatggaactcgatgtatctgcgctgccattgaaggaatcatttccagcgccggtt
ctatcagcgtttcctgtattacatcaagatctagcacttgtcgtagacgagtccgtaccg
gcagaatccgtacgtaaagttatcgaggatgcagcaggagaactactggaaaaggttgag
cttttcgacgtataccgttctgaggcgctaggtgcagagaaaaaatctctcgctttttct
cttgaattccgtgctcaggatcgcactctgacagacgatgaatgttctgaaggtaggctt
gcagctgcgggtcgggccgctgagctattcggtgcgacgatgcgcgcataa

DBGET integrated database retrieval system