KEGG   Corynebacterium diphtheriae VA01: CDVA01_1038Help
Entry
CDVA01_1038       CDS       T01702                                 

Gene name
pheT
Definition
phenylalanyl-tRNA synthetase subunit beta
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDVA01_1038 (pheT)
Enzymes [BR:cdv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     CDVA01_1038 (pheT)
Amino acid related enzymes [BR:cdv01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   CDVA01_1038 (pheT)
Transfer RNA biogenesis [BR:cdv03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CDVA01_1038 (pheT)
 Prokaryotic Type
    CDVA01_1038 (pheT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095451..1097961
Genome map
AA seq 836 aa AA seqDB search
MLISQNWVTELLGRSNPDWKVSPAELDSGYVRVGFETEGYSAIPETTGPLVIGRVETIEE
LEGFKKPIRHCFVNVGDANGTGELQSIVCGARNFQEGSYVVVSLPGAVLPGNFAISARET
YGRMSAGMICSAAELGLSDKQNPGIITLPNEIAEPGTDARSIVGLDDTVFDVNITPDRGY
ALSARGLTRELASAFNLKFVDPAVDLNVAGVDTSDVPEPSGELIKVDLRPETQARRFGVR
KISGIDPKAPTPFWMQRELMLSGQRCVNAATDVTNFVMLLLGQPMHAFDANLIKGGLVVR
NALEGESFETLDHVKRTLSAEDVVISDDAGIQSLAGVMGGTTSEISDETIDVFFEAANWH
PITTARTSRRHKLSTEASRRFERGVDPEIIEVALDVACALLVSIAGGSVESARTLIGSAP
SMPQIRMKTSRPAELAGVAYSDATVIARLKEVGCAVEVDGDDLLVTPPTWRPDMTMSADL
VEEVLRLEGLEDIPAIVPLAPVGSGLSPAQLRRRAIGHALAYSGYAEILPTPFIRNDTFD
VWGLAADDERRSVVTVQNPLDAEYGVLATTLLPSMLEAVTRNVARGQTSVNLFGLQQVSF
KRGSGISPMLDVRQRPSDNEVAELLKSLPVQPLHVATVGAGFMELDGPWGHGRTYSFADA
IESARVVARAAGVELNVENVEMLPWHPGRCAALKAGDHIVGYAGELHPQIVEALNLPART
CAMELDVSALPLKESFPAPVLSAFPVLHQDLALVVDESVPAESVRKVIEDAAGELLEKVE
LFDVYRSEALGAEKKSLAFSLEFRAQDRTLTDDECSEGRLAAAGRAAELFGATMRA
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgctcatttcacaaaactgggtcaccgaattgttaggtcgatcgaacccagattggaaa
gttagcccagctgagctggattcgggatatgtccgagttggatttgaaaccgagggttac
agcgcaatccctgaaacgactggtccactcgtcatcggtcgagttgaaacaattgaagag
ctagagggctttaaaaagccaattcgtcactgcttcgtcaatgttggagacgcgaatggc
actggagagcttcagtccattgtatgcggggcgcgtaatttccaagaaggttcttatgta
gtagtttcacttccaggtgctgttttgcctggtaatttcgcaatttcggcacgtgagaca
tatggacgcatgtcagctggcatgatttgctcggcagcggaattggggctatctgacaag
caaaatcctggaatcataacgcttccgaatgaaatcgccgaaccaggaactgatgcacga
agcattgttggtttggacgatactgtttttgatgtcaatatcacgccagatcgtggatat
gcattgtctgcacgtggattaactcgagaactggcttcggcttttaatctaaagttcgtt
gatcctgcagtagatcttaacgtggctggcgtcgatacttcggatgttccagagccttca
ggtgagttaattaaggttgatctgcgaccagaaacgcaggcacgtcgtttcggagttcgt
aaaatttctggaatcgatccaaaggctcccacaccattttggatgcagcgtgagctcatg
ttgtcaggccagcgttgcgtgaatgccgcaactgacgtgaccaatttcgtcatgttgctt
ttggggcagcctatgcatgcctttgatgccaacttaattaagggcggattggttgtacgt
aatgccctagaaggggagtcttttgagactcttgatcatgtaaagcgtactttgtctgca
gaagacgttgttatctccgatgatgctggtattcaatccttggctggcgttatgggcgga
actacttcagaaatctcagacgaaacaattgatgtattttttgaagctgccaattggcat
ccaattactacagcacgtacgtcgcgtcgccataagctcagcaccgaggcgtcacgacgc
ttcgagcgtggcgttgacccagaaattattgaggtagctctggacgttgcctgcgcctta
cttgtcagtattgctggtggttctgtggaatccgcccgcactttgattggatctgcgcca
agcatgcctcaaatccgtatgaagacgtctcgcccagccgagttggctggagtagcttac
tcggacgctactgtgattgcgcggttgaaagaagtcggatgtgctgtcgaagtcgatggt
gatgatcttcttgtcacgcctcctacgtggcgtccagatatgactatgtctgctgatttg
gttgaagaagttcttcgtctcgaaggattagaggacattccagcaatcgttccgcttgca
cctgtgggatcagggctctcgcctgcgcaattgcgtcgtcgtgcgatcggtcatgcactt
gcatacagtggctatgcggaaatcctacctacgccttttattcgaaacgatacgttcgat
gtgtgggggcttgcagcagacgatgagcgtcgaagcgtcgtcacggtacaaaaccctctc
gatgctgagtacggagttctcgcgactacattgctgccttctatgctcgaggctgttacc
cgcaatgttgctcgagggcaaacttctgtcaatcttttcggtcttcagcaggtatccttc
aaacgtggctcaggtatttcgccaatgctcgatgtccgtcagcgtcctagcgataatgaa
gttgctgagttgctaaaatccttgccagtacaaccactccatgtggcaactgttggtgct
ggttttatggagttagacggaccatggggccatggtcgaacgtattcgtttgctgatgct
atcgagtcggctcgagttgttgcccgtgcagcaggcgttgaacttaacgtcgaaaatgta
gagatgctaccttggcatcctgggcgctgtgctgcattaaaagctggtgaccacattgtt
ggatatgctggcgaattgcatcctcagattgttgaagccttgaatctgccagcacgtacg
tgcgccatggaactcgatgtatctgcgctgccattgaaggaatcatttccagcgccggtt
ctatcagcgtttcctgtattacatcaagatctagcacttgtcgtagacgagtccgtaccg
gcagaatccgtacgtaaagttatcgaggatgcagcaggagaactactggaaaaggttgag
cttttcgacgtataccgttctgaggcgctaggtgcagagaaaaaatctctcgctttttct
cttgaattccgtgctcaggatcgcactctgacagacgatgaatgttctgaaggtaggctt
gcagctgcgggtcgggccgctgagctattcggtgcgacgatgcgcgcataa

DBGET integrated database retrieval system