KEGG   Corynebacterium diphtheriae VA01: CDVA01_1106Help
Entry
CDVA01_1106       CDS       T01702                                 

Gene name
cobL
Definition
precorrin-6Y C5,15-methyltransferase
Orthology
K00595  
precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDVA01_1106 (cobL)
Enzymes [BR:cdv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     CDVA01_1106 (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1178150..1179430)
Genome map
AA seq 426 aa AA seqDB search
MSMEATARVSELGRPKNDDGQAHTGSITVVGIGAGGVEELGAQARTALRQATIIIGSKRQ
LGLLPEDFQGDRIAWPSPLVPAIPALFAEFIDKEVVVLGSGDPMFHGIGSTLHRLLPNHS
MTVIPQPSSASLACARLGWALDTTSVYSLVTHPIAHLTLAIEQGDRFLVLGRNHESPHEI
CEHLISLGQSTAEVTVLSDIGSVSETITSGAATDYPSNDSALNVIAIRPLAATRSRVPGL
PDSEYVTDGQLTKQHVRALTISALAPKPHETLWDIGGGSGSIAIEWLRSTPQTTAVCFEI
SEERRERILSNAINLGVSDRIAVQQGAPRAFDDVPDNPDVIFIGGGLTAPGVFSAAWKRL
PVGGRLVANAVTVESEQMLWALRKQFGGTISSFAISHEHTVGSFITMKPALPVHQWTVVK
ALTKEL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaagcaaccgcgcgcgtttctgaattgggacgccccaaaaacgacgatggc
caagcacacaccggtagcattaccgtcgtcggaattggagctggcggtgtagaagaactc
ggtgcacaagctcgcaccgcactacgccaggccacaatcatcatcggatccaaacgccaa
ctcggactgctccccgaagatttccaaggcgaccgaatcgcatggccatctccgcttgtt
ccagcaatcccagcactcttcgctgaattcatcgacaaagaagtcgtagtccttggatcc
ggtgaccccatgtttcacggtatcggcagcacactccaccgactgcttccaaatcacagc
atgaccgtgattccgcagccatcatcggcatcgctagcatgtgctcgactcggttgggca
ctagatacaacaagcgtctacagcctcgtcacccatcccatcgcacatctcacattagca
atcgaacaaggtgaccgtttcctagtattaggacgcaaccatgagtctccacacgagatc
tgtgaacaccttatttctttaggtcaaagcaccgcagaagtaaccgttctgagcgatatc
ggcagcgttagcgaaacaattacttcaggagcagctactgactacccgtcgaacgattca
gcattgaacgttatcgcgatacgcccactcgccgccacccgaagtagagtaccgggacta
ccagactccgagtacgtcaccgatggtcagctcacaaaacaacacgtccgagcactcacg
atatcagctttggctcctaaacctcatgaaactctgtgggatatcggaggcggatccggt
tccatcgctatcgaatggctgcgttcaacgccacaaacgacagctgtctgcttcgaaata
tcggaagaacgtcgcgaacgaatcctcagcaatgcaatcaacctcggggtatccgatagg
atagcagtgcagcaaggcgcccccagagcatttgacgatgttccagacaaccccgacgtc
atcttcatcggcggtggacttaccgcgccgggcgtgttctcggccgcatggaaacgccta
ccagtagggggtcgattagtagccaacgcagtgacagtagaaagcgaacaaatgctttgg
gcactgcgtaaacaatttggtggaactatcagttcgtttgctatttcgcatgagcacaca
gtgggctcattcatcaccatgaaacctgcattaccggtacaccaatggaccgtagtaaaa
gcattgacaaaggaactctga

DBGET integrated database retrieval system