KEGG   Corynebacterium diphtheriae VA01: CDVA01_1177Help
Entry
CDVA01_1177       CDS       T01702                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00010  Glycolysis / Gluconeogenesis
cdv00051  Fructose and mannose metabolism
cdv00562  Inositol phosphate metabolism
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01120  Microbial metabolism in diverse environments
cdv01130  Biosynthesis of antibiotics
cdv01200  Carbon metabolism
cdv01230  Biosynthesis of amino acids
Module
cdv_M00002  Glycolysis, core module involving three-carbon compounds
cdv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDVA01_1177 (tpi)
   00051 Fructose and mannose metabolism
    CDVA01_1177 (tpi)
   00562 Inositol phosphate metabolism
    CDVA01_1177 (tpi)
Enzymes [BR:cdv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CDVA01_1177 (tpi)
Exosome [BR:cdv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CDVA01_1177 (tpi)
  Exosomal proteins of bladder cancer cells
   CDVA01_1177 (tpi)
  Exosomal proteins of melanoma cells
   CDVA01_1177 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BCSC_C
Motif
Other DBs
NCBI-ProteinID: AEX83446
Position
complement(1259356..1260138)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAGTHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtgcaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcaccgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacact
ggtgaaatctctgcccagatgcttgccaaactcggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagcttgttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtttgtgttggagagccccttgaaattcgtgaa
gctggaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttact
gcagatgatttggcgaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtagcatccgctgccgatgcacaggaagtctgcgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaaccggatgttgatggcggcttagtgggtggc
gcttctcttgacggtgaagcattcgccaaactagcagctaatgcagcaactgttgtcgac
tag

DBGET integrated database retrieval system