KEGG   Corynebacterium diphtheriae VA01: CDVA01_1374Help
Entry
CDVA01_1374       CDS       T01702                                 

Gene name
chlI2
Definition
(GenBank) magnesium chelatase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00860  Porphyrin and chlorophyll metabolism
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDVA01_1374 (chlI2)
Enzymes [BR:cdv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CDVA01_1374 (chlI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase MCM Sigma54_activat AAA_3 AAA AAA_16 AAA_30 AAA_32
Motif
Other DBs
NCBI-ProteinID: AEX83641
Position
complement(1467776..1468861)
Genome map
AA seq 361 aa AA seqDB search
MSTKQSPLFPFSAVVGQDQLRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAALLGDA
PLVNLPIGATEDRVVGSLDMETVLTTGKAKFRPGLLSQAHGGVLYVDEVNLLADHLVDAL
LDAAATGQVTVERDGISHTAPACFVFVGTMNPEEGELRPQLLDRFGLSVDVAASKDVQIR
AEIMRRRLDFESDPIDFAQRWHALDENTSQAIKSAQERVDSIVLSDTNLARIAHICASFD
VDGMRADLVIARTAIAHAAWRGDSLVTDEDIKVAAELALPHRRRRDPFDEPGLDQDQLDE
VMDEARDQHPEMDDPAEQSAHEDQIENETSDQEDHLDDQETQTPDSDGQEGSASQGAPFR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaagcagtctccgctttttcctttttctgccgttgtaggccaagatcaactg
cgactcgcgttaattcttacagcgatttcaccacgaattggtggcgtagtaatccgcggt
gaaaagggaaccgcaaaaacgacgacggttcgtgcatttgcagcgttgctaggtgatgcg
ccactggtcaatcttcccatcggagcaacggaagatcgcgttgttggctcgttagacatg
gagactgtgctaacaacaggaaaagctaagtttcgcccaggcttgctctcccaagcgcat
ggtggtgttttgtacgtcgatgaggtcaacttgttggctgatcatctcgttgatgcgctt
cttgatgcggccgcgactgggcaagtgactgttgaacgtgatggtatttcgcatacagct
cctgcttgttttgtgttcgtaggaaccatgaatccagaagaaggggaattgcggcctcag
ctgctcgatcgttttggactttctgtagatgtagcagcatcgaaggatgttcagattcgg
gcagaaattatgcgcagacgactcgattttgaatctgaccccattgactttgcacaacgc
tggcatgcactagacgagaacacgtcgcaagcaatcaagagcgcgcaagaacgtgtcgat
agcattgtgctcagtgatacaaatttggcacgtatcgctcatatttgtgcttcttttgac
gttgatggcatgcgtgctgatctcgttattgctcgtactgctattgcccatgctgcatgg
cgcggtgattcgctggtgactgacgaggacatcaaagtagcagcagaacttgctctgccg
catcgacggcgtagggacccgtttgatgaacccggccttgatcaagaccaacttgatgaa
gttatggatgaagcacgtgaccagcacccagagatggatgatcctgctgaacaatcagca
catgaggatcaaatagaaaacgaaacttctgatcaggaagatcatctagacgatcaagaa
actcagactcctgattccgatggtcaggagggcagcgcttctcaaggcgccccctttcgt
ccctaa

DBGET integrated database retrieval system