KEGG   Corynebacterium diphtheriae VA01: CDVA01_1503Help
Entry
CDVA01_1503       CDS       T01702                                 

Gene name
ltsA
Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cdv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616830..1618566
Genome map
AA seq 578 aa AA seqDB search
MRWGPEGEPDRYAMTFNGEIYNYVELRKKLQDLGYTFNTSGDGETIAVGFHHWGADVVLH
LRGMFGIAIWDTKEQRLFLARDQFGIKPLYFATTEAGTVFASEKKCILDMADAIGLDLGL
DQRAIEHYIDLQYVPEPESLHQHIRRLESGCFAFVSVGGNVDQTRYFRPQFPAQEFPKDK
EQDLFDRIAKALEDSVEKHMRADVTVGSFLSGGIDSTAIATLAKRHNPNLLTFTTGFERE
GYSEVDVAAESAAAIGVEHIVKIVSPEEYANAIPQIMWYLDDPVADPSLVPLFFVAQEAR
KHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRRGLGKVAEVFPDGMRGKSLLQ
RGSMTMEERYYGNARSFNFDQMKRVIPWAKKEWDHREVTAPIYAQSEHMDPVARMQHLDL
FTWMRGDILVKADKINMAHSLELRVPFLDKEVFEVAETIPYDLKIANGTTKYALRKAMEQ
IVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTINESMTDQYFDKAAVLAMLNEHKNGV
SDHSRRLWTVLAFMIWHGIFVEHRIDPGIEKRDYPVYL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatgggggcctgaaggcgagcccgaccgctatgccatgacttttaatggcgagatc
tacaactatgtagagctacgaaaaaaacttcaagacctcggctacacctttaacacttca
ggcgacggcgaaactattgctgtcggtttccaccactggggtgcagatgtagtgcttcac
ttgcgcggaatgtttggcatagccatttgggacaccaaggaacaacgtcttttcttggcc
cgcgatcaatttggtatcaagccgttgtactttgctaccaccgaagctggcaccgttttc
gcctccgagaaaaagtgcatcttggatatggcagatgctattggtctagatttggggctt
gaccaacgtgctatcgagcactacatcgatcttcaatacgttccagagcctgaaagtctt
catcagcacattcgacgcctagagtctggctgctttgctttcgtttctgtgggaggcaat
gtcgatcagactcgttacttccgtcctcagttccccgcacaagaattcccaaaggacaag
gaacaggatctcttcgatcgaatcgccaaggccctagaagatagcgtcgaaaagcacatg
cgtgccgacgtcactgtcggttctttcctgtctggcggcatcgactccactgcgattgca
actttggcaaaacgccataatccgaatctgttgacattcactacaggatttgaacgcgaa
ggatattcggaagtcgatgtggctgcagaatccgctgctgccattggagtagaacatatc
gtcaagattgtctctcccgaggaatatgccaatgccattcctcaaatcatgtggtacttg
gatgacccagtagctgatccctccctagtcccactattcttcgttgctcaagaagcccgc
aagcatgtcaaagtggtgttgtcaggcgaaggagcagacgaactatttggtggttacacc
atttacaaagagccgctttctcttgctccatttgaaaagattccttccccgctacgtcgc
ggtcttggcaaagtagccgaagttttccctgacggaatgcgtggtaaatccttgctccaa
cgcggttcaatgacgatggaagagcgttattacggaaatgctcgttccttcaattttgat
caaatgaagcgcgttatcccatgggccaagaaggaatgggatcaccgcgaagtcaccgca
ccgatctacgcccagtctgagcacatggaccccgttgcgcgaatgcagcatttggatctt
ttcacgtggatgcgcggcgatatcctcgtcaaggccgacaagatcaacatggctcactcc
ttggaacttcgcgtcccgttcttggataaggaagtatttgaggttgctgaaaccattcct
tatgacctcaagattgctaacggaacgaccaaatatgcgttgcgtaaggccatggaacaa
atcgttccgccgcacgtgctgcaccgcaagaaactcggattcccagtgcctatgcgacac
tggctagctggcgatgagctgttcggttgggctcaagacaccattaatgagtcgatgacc
gaccaatactttgacaaggcagcagtcttagcaatgctcaatgaacacaagaatggtgta
tctgatcattcccgcaggctatggacagtcctcgcctttatgatttggcacggaattttc
gtcgagcaccgcattgatccaggcatcgagaaacgcgattatcctgtgtacctatag

DBGET integrated database retrieval system