KEGG   Corynebacterium diphtheriae VA01: CDVA01_1503Help
Entry
CDVA01_1503       CDS       T01702                                 

Gene name
ltsA
Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDVA01_1503 (ltsA)
Enzymes [BR:cdv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CDVA01_1503 (ltsA)
Peptidases [BR:cdv01002]
 Cysteine Peptidases
  Family C44
   CDVA01_1503 (ltsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616830..1618566
Genome map
AA seq 578 aa AA seqDB search
MRWGPEGEPDRYAMTFNGEIYNYVELRKKLQDLGYTFNTSGDGETIAVGFHHWGADVVLH
LRGMFGIAIWDTKEQRLFLARDQFGIKPLYFATTEAGTVFASEKKCILDMADAIGLDLGL
DQRAIEHYIDLQYVPEPESLHQHIRRLESGCFAFVSVGGNVDQTRYFRPQFPAQEFPKDK
EQDLFDRIAKALEDSVEKHMRADVTVGSFLSGGIDSTAIATLAKRHNPNLLTFTTGFERE
GYSEVDVAAESAAAIGVEHIVKIVSPEEYANAIPQIMWYLDDPVADPSLVPLFFVAQEAR
KHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRRGLGKVAEVFPDGMRGKSLLQ
RGSMTMEERYYGNARSFNFDQMKRVIPWAKKEWDHREVTAPIYAQSEHMDPVARMQHLDL
FTWMRGDILVKADKINMAHSLELRVPFLDKEVFEVAETIPYDLKIANGTTKYALRKAMEQ
IVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTINESMTDQYFDKAAVLAMLNEHKNGV
SDHSRRLWTVLAFMIWHGIFVEHRIDPGIEKRDYPVYL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatgggggcctgaaggcgagcccgaccgctatgccatgacttttaatggcgagatc
tacaactatgtagagctacgaaaaaaacttcaagacctcggctacacctttaacacttca
ggcgacggcgaaactattgctgtcggtttccaccactggggtgcagatgtagtgcttcac
ttgcgcggaatgtttggcatagccatttgggacaccaaggaacaacgtcttttcttggcc
cgcgatcaatttggtatcaagccgttgtactttgctaccaccgaagctggcaccgttttc
gcctccgagaaaaagtgcatcttggatatggcagatgctattggtctagatttggggctt
gaccaacgtgctatcgagcactacatcgatcttcaatacgttccagagcctgaaagtctt
catcagcacattcgacgcctagagtctggctgctttgctttcgtttctgtgggaggcaat
gtcgatcagactcgttacttccgtcctcagttccccgcacaagaattcccaaaggacaag
gaacaggatctcttcgatcgaatcgccaaggccctagaagatagcgtcgaaaagcacatg
cgtgccgacgtcactgtcggttctttcctgtctggcggcatcgactccactgcgattgca
actttggcaaaacgccataatccgaatctgttgacattcactacaggatttgaacgcgaa
ggatattcggaagtcgatgtggctgcagaatccgctgctgccattggagtagaacatatc
gtcaagattgtctctcccgaggaatatgccaatgccattcctcaaatcatgtggtacttg
gatgacccagtagctgatccctccctagtcccactattcttcgttgctcaagaagcccgc
aagcatgtcaaagtggtgttgtcaggcgaaggagcagacgaactatttggtggttacacc
atttacaaagagccgctttctcttgctccatttgaaaagattccttccccgctacgtcgc
ggtcttggcaaagtagccgaagttttccctgacggaatgcgtggtaaatccttgctccaa
cgcggttcaatgacgatggaagagcgttattacggaaatgctcgttccttcaattttgat
caaatgaagcgcgttatcccatgggccaagaaggaatgggatcaccgcgaagtcaccgca
ccgatctacgcccagtctgagcacatggaccccgttgcgcgaatgcagcatttggatctt
ttcacgtggatgcgcggcgatatcctcgtcaaggccgacaagatcaacatggctcactcc
ttggaacttcgcgtcccgttcttggataaggaagtatttgaggttgctgaaaccattcct
tatgacctcaagattgctaacggaacgaccaaatatgcgttgcgtaaggccatggaacaa
atcgttccgccgcacgtgctgcaccgcaagaaactcggattcccagtgcctatgcgacac
tggctagctggcgatgagctgttcggttgggctcaagacaccattaatgagtcgatgacc
gaccaatactttgacaaggcagcagtcttagcaatgctcaatgaacacaagaatggtgta
tctgatcattcccgcaggctatggacagtcctcgcctttatgatttggcacggaattttc
gtcgagcaccgcattgatccaggcatcgagaaacgcgattatcctgtgtacctatag

DBGET integrated database retrieval system