KEGG   Corynebacterium diphtheriae VA01: CDVA01_1586Help
Entry
CDVA01_1586       CDS       T01702                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cdv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702856..1705024
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVEGDPYVINVHVHDGAPADITITLEDGST
AEVTQVENWAPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYAEHPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQNDVAELAEEFTALNLTPEKIERNPI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCADQELAVLESSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREELGILTTDVA
TEYAEDLNWQADILNVVRNSGAFESIVPAEFHGVDRADRGSSVELLSALHRFLAGTPSAL
TCTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENPVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagaccctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggatcaaatccgctacgcgctgcaacaacgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaggcgatccctacgtgatcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactgggccccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgaccttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgtttcctcatcgtgaccccagcgcgtctatctacc
gccgacaagtatgcagagcaccctgtcagcggtgttatggcgcagctgtactctgctcgt
agtaagaattcttggggcatgggcgatttcaacgatctcggcctgctggctgagacgctt
gctcctcaggctgactatctgttgattaaccctctgcacgccgctgagccgatgccacca
gttgaggattccccatacttgcctactacgcggcgttttatcaacccaatttatatccgc
atcgaagatatccctgagcacttgcttctcgacgatgacctacagaatgatgtcgccgag
ctcgcggaagagttcacagcacttaatctcacccctgaaaagattgagcgcaatccaatt
tttgatgccaagttgcaggttctgcacgcggtattcaatgtagagcgcgaacctgcacgt
gaacaggacttccaggacttcatcgccaccgaaggccaaggcctacgcgacttcgcttcg
tggtgtgccgaccaagaactagcagttttggagagctccgcagcacatgccgctcttccg
gaaaaagaatctctgattcagttctacatgtggcagcaatggatctgcgatcagcagctg
ggtgccgctcaaacccgcgcaacggatgccggcatgagcattggtatcatcgccgatctc
gccgtgggcattcaccctgcgggtgccgatgcactttcgcttgccgacaccttagtcgcc
cgtgcttcggtaggtgcgccaccagatagctacaaccaccaaggccaagactggtcgcag
ccaccatggcacccagaccgcttggcagagtctggctatatcccatggcgtgacctgctg
cgcacggtgcttcgccacgccggtggtgtccgtgtagaccacattcttggtcttttccgc
ttgttctggattccacgcacccagtccccacaaacgggtacttacgtcaactacgatcac
aacgcacttgtgggcgtacttgctcttgaggcagagcgtgcaggcgcagtggttatcggt
gaagacctcggtaccttcgagccatgggtccaagacttccttgcgtcccgaggcatcatg
ggtacttcagtgctgtggttcgaaagttccccagaaggtggcccacgcaagcagcatgag
tatcgccaattggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
ctggcaggcgagcacattgcgttgcgtgaggaactcggaattttgaccaccgatgtagca
actgagtatgccgaggatttgaactggcaggcagacatcctcaatgtagttcgcaactcg
ggcgcatttgagtccatcgttcctgccgaattccacggtgtagatcgtgctgaccgcggc
agctccgtcgaactgctttccgcacttcaccgttttttggctggtacaccgtcagctctg
acctgtaccgcattggtggatcttgtcgccgataagcgtgcgcagaaccagccgggtact
acttcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaaccccgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system