KEGG   Corynebacterium diphtheriae VA01: CDVA01_1773Help
Entry
CDVA01_1773       CDS       T01702                                 

Gene name
gpx
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cdv00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cdv00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1906248..1906718)
Genome map
AA seq 156 aa AA seqDB search
MSIFDTEVTLINGEKASMDQWAGHCLLIVNTASECGYTPQLETLEELYEDYAMRGFFVIG
VPCNQFGEEEPGKDAQVARRYEEKFGVRFPLLAKSDVNGPNTIELYKKLKGDGPDIEWNF
EKFIVAPSGEVVGRFAPSLDPDDMKIINVLEEYLPI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttgataccgaggtcacgctgatcaacggcgagaaagcctcaatggatcag
tgggctggtcattgcctgttgattgtgaatacggcatcagagtgcggttataccccgcag
ctggagacgctggaagagctttatgaggattatgcgatgcgtggtttcttcgtaatcggt
gttccgtgtaaccagttcggggaggaagaacctggcaaggatgctcaggtggcgcgtcga
tacgaagaaaagtttggggtgcgcttcccgctgttggctaagtcggacgtcaatggcccc
aacactattgagctgtataagaagctcaagggtgatggtccagatattgagtggaacttt
gaaaagtttatcgtagcgcccagcggtgaggtggtaggccgctttgcgccctcgcttgat
cctgacgatatgaagatcattaacgtcttagaagagtatcttcctatctaa

DBGET integrated database retrieval system