KEGG   Corynebacterium diphtheriae VA01: CDVA01_2160Help
Entry
CDVA01_2160       CDS       T01702                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00010  Glycolysis / Gluconeogenesis
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01120  Microbial metabolism in diverse environments
cdv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDVA01_2160
Enzymes [BR:cdv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CDVA01_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX84424
Position
complement(2357255..2358034)
Genome map
AA seq 259 aa AA seqDB search
MSDQIADARLMPSGAILTRMSTVVDMPETRGHLISAITTASDPGEILYLSSRADFSEGGS
IRGGVPIIAPWFAKNLGHDELQHGWARRVEWETIPTNGGIDARTSHDDWDLRLGTQVLSH
GFAMMLKARNASPLRRDFQSAFHPYFRVADVRTTTVTVGDQEFRFDGTAVDQAVPLPEWT
PLVIKDSQRTITVTYQGADHAVVWNPGSELAAQMTDVGEDEWTEFVCVEPALLGDQAQGV
SVPPWDWVEIGMTVKVTPA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatcaaattgcagacgcgcggctcatgccgtcgggggctatccttacaagaatg
agcaccgttgtagatatgcctgagactcgcggacatttgatatctgcgattactaccgcc
agcgatcctggcgagattctttacttatccagtcgcgcggatttttccgagggtggttcg
atccgtggtggtgtcccgatcatcgcaccgtggtttgctaagaacttggggcacgatgag
ttgcagcatggttgggcgcgccgggtggagtgggagacgatccctaccaatggcggtatc
gacgcccgcacgagccacgatgattgggatctgcgccttggtacgcaggtactttctcat
ggttttgccatgatgttgaaggcccgcaacgcttccccattgcggcgcgattttcaatcc
gcgttccacccgtatttccgcgttgctgatgtgcgcaccaccaccgtaacggtgggcgat
caggagtttcgtttcgacggcaccgccgtcgaccaagcggtccctctgccagagtggacg
ccattggttatcaaggattcccagcgcactattaccgtcacctaccaaggtgccgaccat
gctgtggtatggaatcctggcagcgagcttgccgcacagatgacagatgtgggtgaagac
gaatggaccgagtttgtctgtgtagaaccagcattgttgggtgaccaagcccaaggtgtt
tccgttcctccatgggattgggtagagatcggtatgaccgtgaaggtcacaccggcttag

DBGET integrated database retrieval system