KEGG   Corynebacterium diphtheriae PW8: CDPW8_0220Help
Entry
CDPW8_0220        CDS       T01701                                 

Gene name
tox2
Definition
diphtheria toxin
Orthology
K00776  
NAD-diphthamide ADP-ribosyltransferase [EC:2.4.2.36]
Organism
cdw  Corynebacterium diphtheriae PW8
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
212027..213709
Genome map
AA seq 560 aa AA seqDB search
MSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGI
QKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALK
VDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQ
AKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKT
KIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAG
ANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIAL
SSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYA
VSWNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGR
KIRMRCRAIDGDVTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQ
KTVDHTKVNSKLSLFFEIKS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaaaactgtttgcgtcaatcttaataggggcgctactggggataggggcccca
ccttcagcccatgcaggcgctgatgatgttgttgattcttctaaatcttttgtgatggaa
aacttttcttcgtaccacgggactaaacctggttatgtagattccattcaaaaaggtata
caaaagccaaaatctggtacacaaggaaattatgacgatgattggaaagggttttatagt
accgacaataaatacgacgctgcgggatactctgtagataatgaaaacccgctctctgga
aaagctggaggcgtggtcaaagtgacgtatccaggactgacgaaggttctcgcactaaaa
gtggataatgccgaaactattaagaaagagttaggtttaagtctcactgaaccgttgatg
gagcaagtcggaacggaagagtttatcaaaaggttcggtgatggtgcttcgcgtgtagtg
ctcagccttcccttcgctgaggggagttctagcgttgaatatattaataactgggaacag
gcgaaagcgttaagcgtagaacttgagattaattttgaaacccgtggaaaacgtggccaa
gatgcgatgtatgagtatatggctcaagcctgtgcaggaaatcgtgtcaggcgatcagta
ggtagctcattgtcatgcataaatcttgattgggatgtcataagggataaaactaagaca
aagatagagtctttgaaagagcatggccctatcaaaaataaaatgagcgaaagtcccaat
aaaacagtatctgaggaaaaagctaaacaatacctagaagaatttcatcaaacggcatta
gagcatcctgaattgtcagaacttaaaaccgttactgggaccaatcctgtattcgctggg
gctaactatgcggcgtgggcagtaaacgttgcgcaagttatcgatagcgaaacagctgat
aatttggaaaagacaactgctgctctttcgatacttcctggtatcggtagcgtaatgggc
attgcagacggtgccgttcaccacaatacagaagagatagtggcacaatcaatagcttta
tcgtctttaatggttgctcaagctattccattggtaggagagctagttgatattggtttc
gctgcatataattttgtagagagtattatcaatttatttcaagtagttcataattcgtat
aatcgtcccgcgtattctccggggcataaaacgcaaccatttcttcatgacgggtatgct
gtcagttggaacactgttgaagattcgataatccgaactggttttcaaggggagagtggg
cacgacataaaaattactgctgaaaataccccgcttccaatcgcgggtgtcctactaccg
actattcctggaaagctggacgttaataagtccaagactcatatttccgtaaatggtcgg
aaaataaggatgcgttgcagagctatagacggtgatgtaactttttgtcgccctaaatct
cctgtttatgttggtaatggtgtgcatgcgaatcttcacgtggcatttcacagaagcagc
tcggagaaaattcattctaatgaaatttcgtcggattccataggcgttcttgggtaccag
aaaacagtagatcacaccaaggttaattctaagctatcgctattttttgaaatcaaaagc
tga

DBGET integrated database retrieval system