KEGG   Corynebacterium diphtheriae PW8: CDPW8_0277Help
Entry
CDPW8_0277        CDS       T01701                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cdw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267388..268044
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDEFSRLPGVGPKSAQRIAFHLLHVEPADITRLQDALGAIRDGVTFCRICC
NISREEVCRICADSSRDRSTICVVEEPKDIQVIERTGEYTGRYHVLGGSLDPLANIGPRE
LNISQLLQRIGGVLPDRELADSTPEAPLYDASPEVREVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggacctctccaagacctgattgacgagttttctcggctccctggtgtgggg
ccgaagtcggctcagcgcattgctttccacctgctccatgtggaaccagcagacattacg
cgtctgcaagatgcgctgggtgctattcgtgacggtgttactttctgccgcatttgctgc
aatatctctcgcgaagaggtctgccgcatttgtgcggactcttcacgcgaccgcagcacc
atctgtgtggtggaagaacccaaagacattcaggttattgaacgaaccggcgagtacaca
ggtcgctaccatgtgctcggcggctcgcttgacccccttgccaacattggcccccgtgag
ctcaacatttcgcaattgttgcagcgtatcggcggcgtgttgccagaccgtgagcttgcc
gactccacccccgaggcaccgctttacgacgcctccccagaagtgcgcgaggttatcctc
gccaccgaccccaacaccgaaggcgaagccacagcctcctacctagcacggctgctgcgc
gacttcccagaccttgtggtgtcacgccttgcctccggcatgccactcggcggcgaccta
gagttcgttgacgaacttacactgtcgcgtgcgctgagcggcagactgacgctgtag

DBGET integrated database retrieval system