KEGG   Corynebacterium diphtheriae PW8: CDPW8_0389Help
Entry
CDPW8_0389        CDS       T01701                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00010  Glycolysis / Gluconeogenesis
cdw00260  Glycine, serine and threonine metabolism
cdw00680  Methane metabolism
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01120  Microbial metabolism in diverse environments
cdw01130  Biosynthesis of antibiotics
cdw01200  Carbon metabolism
cdw01230  Biosynthesis of amino acids
Module
cdw_M00002  Glycolysis, core module involving three-carbon compounds
cdw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDPW8_0389 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDPW8_0389 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDPW8_0389 (gpmA)
Enzymes [BR:cdw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDPW8_0389 (gpmA)
Membrane trafficking [BR:cdw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CDPW8_0389 (gpmA)
Exosome [BR:cdw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDPW8_0389 (gpmA)
  Exosomal proteins of melanoma cells
   CDPW8_0389 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX69051
Position
388614..389360
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVKNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
cagttcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtgtacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccactggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaacaag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttac
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtgaagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagcttgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system