KEGG   Corynebacterium diphtheriae PW8: CDPW8_0389Help
Entry
CDPW8_0389        CDS       T01701                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDPW8_0389 (gpmA)
   01230 Biosynthesis of amino acids
    CDPW8_0389 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDPW8_0389 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDPW8_0389 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDPW8_0389 (gpmA)
Enzymes [BR:cdw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDPW8_0389 (gpmA)
Exosome [BR:cdw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDPW8_0389 (gpmA)
  Exosomal proteins of melanoma cells
   CDPW8_0389 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
388614..389360
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVKNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
cagttcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtgtacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccactggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaacaag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttac
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtgaagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagcttgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system