KEGG   Corynebacterium diphtheriae PW8: CDPW8_0408Help
Entry
CDPW8_0408        CDS       T01701                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDPW8_0408 (hemG)
Enzymes [BR:cdw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CDPW8_0408 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
407013..408365
Genome map
AA seq 450 aa AA seqDB search
MRIAIIGAGLAGLTAAYRLRDHDVSVFEATDRIGGKLHTVAFQSGPTDMGAEAYLAFRED
TTAFFKELGLEVVSPSGLPSLLYVNGELHPMPMNTVMGIPGSSKGLEKLVSAETAARIDA
ESDSMDWPQEVTLGEVLRERFGDDLVDHVVSALQGGVYSSTSDDLSLRDTVPQLARALDR
LKEEGKPVTITAAVQSIMADREKRNKARGYKPSVFAAFPGGYAELYEALAEKSGAKIHID
AFITGIQWKDGFTLTGAEGTFDKVIVAVPAPTAAMLLKSVAPEASALLKNIKLASSAVVG
MKFDSAEGLPDNSGILVATDAEVTAKAFTFSSKKWPHLGQRGGALVRASFGRFGDDAIAR
ADEDLLVDTALDDLQTITGFDGRAAGLSEIYVQRWFGGLPVYGPGHSDLVAAIKDTLPVG
IYATGAWADGVGVPAVIDSATKVAKLLEDH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattgcaatcattggtgcggggcttgcgggtttgactgcggcgtatcgtcttcgt
gaccatgatgtttcggttttcgaggcgactgaccgtattggtggcaagctgcatacggtt
gcgtttcagtctggccctacggatatgggcgcagaggcgtatttggcgtttcgtgaggat
acgacggccttttttaaggagttaggtcttgaggttgtgtcgccttcggggttgccgtcg
ttgttgtatgtcaatggtgagttgcatccgatgccgatgaatacggtgatggggattcca
ggctcgtcgaagggtttggagaagttggtgagtgcggagactgccgcgcgtatcgacgcc
gaatctgattccatggactggcctcaggaggtgactctgggggaggttttgcgtgagcgc
tttggcgatgacctggtggatcacgtggtgtcggcgttgcaaggtggtgtgtattcctct
acttctgatgatctttcgttgcgggatacggttccgcagttggcgcgtgcgttggatcgt
ctgaaagaagaaggcaagccagtgacaattaccgctgcggtgcagtcgattatggctgat
cgtgagaagcgtaataaggcccgtggttataagccgagtgtttttgcggctttccctggt
ggttatgcagaattgtatgaggcgctggcggagaagtcgggtgcgaagatccacattgat
gcctttattactggcattcagtggaaggatgggttcacgctgacgggtgctgagggaacc
tttgacaaggtgattgtggcggttccagctccgacagcggcgatgttgttgaagtctgtg
gcaccggaggcgtcggcgttgctgaaaaacatcaagttggcgagctctgcggtggtgggc
atgaagttcgattccgcggaggggctgccggataattcgggcattttggttgcgacggat
gcagaggttactgcgaaggcgtttacattttcttcgaagaagtggccgcatttggggcag
cgcggtggcgcgttggtgcgtgcgtcgtttggccgttttggtgatgatgccattgcgcgt
gccgacgaagacctgctggtggataccgcccttgatgatcttcagactattacgggtttt
gatggccgtgcggctgggttgtcggagatctatgtgcagcgctggttcggtggattgccg
gtgtacggcccagggcatagcgatcttgtggctgcgattaaggacacactgccagtaggt
atttatgccaccggcgcttgggccgatggcgtgggtgttcctgcggtgattgattctgca
actaaggtggcaaagttactggaagatcactga

DBGET integrated database retrieval system