KEGG   Corynebacterium diphtheriae PW8: CDPW8_0518Help
Entry
CDPW8_0518        CDS       T01701                                 

Definition
(GenBank) putative regulatory protein sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00010  Glycolysis / Gluconeogenesis
cdw00052  Galactose metabolism
cdw00500  Starch and sucrose metabolism
cdw00520  Amino sugar and nucleotide sugar metabolism
cdw00521  Streptomycin biosynthesis
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01120  Microbial metabolism in diverse environments
cdw01130  Biosynthesis of antibiotics
cdw01200  Carbon metabolism
Module
cdw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDPW8_0518
   00052 Galactose metabolism
    CDPW8_0518
   00500 Starch and sucrose metabolism
    CDPW8_0518
   00520 Amino sugar and nucleotide sugar metabolism
    CDPW8_0518
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDPW8_0518
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDPW8_0518
Enzymes [BR:cdw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDPW8_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEX69180
Position
517649..518533
Genome map
AA seq 294 aa AA seqDB search
MTHALGVDIGGTKIAVGIVDSTDPTTVINRHIVPTPDHDVIDRVRDAIAHIITPEVTSIG
IGAPGVIDETTGVVVSSGPTMQGWAGTRIADTIAAEFSLPVAVHNDVRVMGLGESIYGAG
RDYTNVLFVSLGTGVGGAIVRDGRLVASPHHTAGELRALIGRLPDGRADLLENFAAGPGL
AQRFGELYSEHAGRDLRFIMELYRAGDTHARDYITATLAAAGETIAGFASAIDVDAIIIG
GGVGNIGDAIIKPFAHGFAAHAIPPLGTIPIRQAQLGTDAPIVGAAHLGHSAIE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcactcggtgtcgacatcggcggcactaaaatcgcagtcggaatcgtagac
agcacggaccccaccaccgtaatcaaccgacacatcgtccccacacccgaccacgacgtg
atcgaccgcgtacgcgacgcgatcgcccacatcatcaccccagaagtaaccagcattggc
atcggcgcgccgggtgttatcgacgaaaccacaggagtagttgtctcctccggtcccacc
atgcaaggctgggctggcacacgcatcgcggatactatcgccgcggaattttcgctaccc
gtcgccgtgcataacgacgtccgcgtcatggggctcggcgaatccatctacggcgccgga
cgcgactacaccaatgtgctctttgtcagccttgggacaggtgtcggcggcgccattgtt
cgtgacggacgcctcgtagcatccccgcaccacactgcaggcgaacttcgggcactcatc
ggcaggcttcccgacggccgcgcagacctcctagaaaacttcgccgcaggacccggcttg
gcacaaagattcggtgaactctactccgaacacgcaggtcgtgacctgcgattcatcatg
gagctctaccgcgcaggagacacccacgcccgcgactacatcaccgcaacacttgcagca
gcaggcgaaaccatcgcaggattcgccagcgccatcgacgtagacgccatcatcatcggc
ggcggagtaggcaacatcggcgacgccatcatcaaaccatttgcccacggattcgcagcc
cacgccattccaccgctgggcacgatccccatccggcaagcacaacttggcaccgacgca
ccgatcgtcggcgcagcacaccttggccacagcgccatcgaataa

DBGET integrated database retrieval system