KEGG   Corynebacterium diphtheriae PW8: CDPW8_0785Help
Entry
CDPW8_0785        CDS       T01701                                 

Gene name
echA2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00071  Fatty acid degradation
cdw00280  Valine, leucine and isoleucine degradation
cdw00310  Lysine degradation
cdw00360  Phenylalanine metabolism
cdw00380  Tryptophan metabolism
cdw00410  beta-Alanine metabolism
cdw00627  Aminobenzoate degradation
cdw00640  Propanoate metabolism
cdw00650  Butanoate metabolism
cdw00903  Limonene and pinene degradation
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01120  Microbial metabolism in diverse environments
cdw01130  Biosynthesis of antibiotics
cdw01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDPW8_0785 (echA2)
   00650 Butanoate metabolism
    CDPW8_0785 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDPW8_0785 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDPW8_0785 (echA2)
   00310 Lysine degradation
    CDPW8_0785 (echA2)
   00360 Phenylalanine metabolism
    CDPW8_0785 (echA2)
   00380 Tryptophan metabolism
    CDPW8_0785 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDPW8_0785 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDPW8_0785 (echA2)
   00281 Geraniol degradation
    CDPW8_0785 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDPW8_0785 (echA2)
   00627 Aminobenzoate degradation
    CDPW8_0785 (echA2)
   00930 Caprolactam degradation
    CDPW8_0785 (echA2)
Enzymes [BR:cdw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDPW8_0785 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1
Motif
Other DBs
NCBI-ProteinID: AEX69441
Position
796913..797284
Genome map
AA seq 123 aa AA seqDB search
MPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVATGFALEIADSDSAIAY
AHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDAREGQLARKQKRDPVF
TGR
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggcgtctcttgggttcgcgctcgacggatggactattaatagggcacagtgt
ttgctgggcggcggttgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccg
caggcggtggcaactggttttgcgctggagatcgctgattccgattctgcgattgcctat
gctcatcgtattgctggaatggcacccttggcgctgcgacaacttaaatccgcgctcaac
agtgctgattttgaatatgcgcttgttggggaatctcgtgatctttttgcccaatgttgg
gctagtacggatgctcgcgaagggcagctggctcgaaaacaaaagcgagatccggtattt
actggtcgctga

DBGET integrated database retrieval system