KEGG   Corynebacterium diphtheriae PW8: CDPW8_0785Help
Entry
CDPW8_0785        CDS       T01701                                 

Gene name
echA2
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cdw01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cdw00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cdw00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cdw00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cdw00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cdw00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:cdw00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cdw00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cdw00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:cdw00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cdw00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796913..797284
Genome map
AA seq 123 aa AA seqDB search
MPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVATGFALEIADSDSAIAY
AHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDAREGQLARKQKRDPVF
TGR
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggcgtctcttgggttcgcgctcgacggatggactattaatagggcacagtgt
ttgctgggcggcggttgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccg
caggcggtggcaactggttttgcgctggagatcgctgattccgattctgcgattgcctat
gctcatcgtattgctggaatggcacccttggcgctgcgacaacttaaatccgcgctcaac
agtgctgattttgaatatgcgcttgttggggaatctcgtgatctttttgcccaatgttgg
gctagtacggatgctcgcgaagggcagctggctcgaaaacaaaagcgagatccggtattt
actggtcgctga

DBGET integrated database retrieval system