KEGG   Corynebacterium diphtheriae PW8: CDPW8_0785Help
Entry
CDPW8_0785        CDS       T01701                                 

Gene name
echA2
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDPW8_0785 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDPW8_0785 (echA2)
   00650 Butanoate metabolism
    CDPW8_0785 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDPW8_0785 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDPW8_0785 (echA2)
   00310 Lysine degradation
    CDPW8_0785 (echA2)
   00360 Phenylalanine metabolism
    CDPW8_0785 (echA2)
   00380 Tryptophan metabolism
    CDPW8_0785 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDPW8_0785 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDPW8_0785 (echA2)
   00281 Geraniol degradation
    CDPW8_0785 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDPW8_0785 (echA2)
   00627 Aminobenzoate degradation
    CDPW8_0785 (echA2)
   00930 Caprolactam degradation
    CDPW8_0785 (echA2)
Enzymes [BR:cdw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDPW8_0785 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796913..797284
Genome map
AA seq 123 aa AA seqDB search
MPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVATGFALEIADSDSAIAY
AHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDAREGQLARKQKRDPVF
TGR
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggcgtctcttgggttcgcgctcgacggatggactattaatagggcacagtgt
ttgctgggcggcggttgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccg
caggcggtggcaactggttttgcgctggagatcgctgattccgattctgcgattgcctat
gctcatcgtattgctggaatggcacccttggcgctgcgacaacttaaatccgcgctcaac
agtgctgattttgaatatgcgcttgttggggaatctcgtgatctttttgcccaatgttgg
gctagtacggatgctcgcgaagggcagctggctcgaaaacaaaagcgagatccggtattt
actggtcgctga

DBGET integrated database retrieval system