KEGG   Corynebacterium diphtheriae PW8: CDPW8_0946Help
Entry
CDPW8_0946        CDS       T01701                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdw01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cdw00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961667..962764
Genome map
AA seq 365 aa AA seqDB search
MLDLTTNPIDLTRALVDIESPSHFEKNIADAIEQALHAIDNVEVLRHGNTLVARTHRGLG
ERVILAGHIDTVPIADNVPSHMEGDVMFGCGTVDMKSGMAVYLHAFATLANHPALAKDLT
VVCYEGEEVASEYNGLGHVQAAHPDWLSGDLALLGEPSGAVIEAGCQGTIRLRVTAHGVR
AHSARSWLGDNAMHKLAPVITNIAQYDAQEVLVDGCLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPNRSVDEALAHMLEVLDLPDGVTYDIDDAVPGARPGLDRPAAAALLEATGG
KFRAKYGWTDVSRFSEIGVPAVNFGPGDPAYCHKKDEQCPVSMITEVSRTLVHYLTSTNF
QTTGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttgactacgaatcccattgacctcacccgcgcacttgttgatatagaaagc
ccctcccatttcgaaaagaatatagctgacgccatcgagcaggctcttcatgccatcgac
aatgttgaagtgctacgccacggcaatactcttgttgctcgtacccatcgaggactagga
gaaagggtaatcctcgccggccacatcgacaccgtcccaatagccgacaacgttcctagc
cacatggaaggcgacgtaatgttcggctgcggcaccgtcgatatgaaatcgggcatggct
gtctatcttcatgcctttgccaccttggctaaccacccagcgctggcgaaggacttgacc
gtcgtctgttatgagggcgaggaagtcgctagtgaatacaacggactagggcatgtgcag
gcagctcaccccgactggttaagtggcgatctcgccctcctaggcgagccctctggtgct
gtgatcgaggctggatgccaaggaacgattcgtttgcgcgtcaccgcccatggtgttcgc
gcacactcggcacggtcgtggctaggagacaacgccatgcacaaattagcgccagttatt
acgaatatcgcacaatacgacgcccaagaagtgcttgtcgacggctgcctctaccacgag
ggcctcaacatcgtgcattgcgaatctggggttgccacgaacactattcccgatgaggct
tggatgtttgttaacttccgtttcgcacctaataggagtgttgacgaagccctagcccac
atgctggaggtgttggatctgcccgatggggtgacctatgacatcgacgatgctgttcca
ggggcacgtccgggtttggatcgtccggcagctgccgccctcctagaggcgacaggcgga
aaattccgcgcaaagtacggttggacggatgtgtcgaggttttctgagattggtgttcca
gcggtgaactttggtcctggggatccggcatattgccataaaaaagacgaacaatgccca
gtcagcatgattaccgaagtctctcgcacgctggtgcactatctcacgagtacgaatttc
cagacgacaggagcctga

DBGET integrated database retrieval system