KEGG   Corynebacterium diphtheriae PW8: CDPW8_1039Help
Entry
CDPW8_1039        CDS       T01701                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDPW8_1039 (glgB)
Enzymes [BR:cdw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CDPW8_1039 (glgB)
Exosome [BR:cdw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDPW8_1039 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1057434..1059632)
Genome map
AA seq 732 aa AA seqDB search
MVSPTQITPVHPDVLHALKICQYHDPHGVYGWHEVDAERAVIRTRHIGAERVEALLSDST
VVELAAVGDDIFEAIVDHDASCDYRLRIHWQGGQVTEQADAYHFLPTLGDLDLHLINEGR
HERLWEVLGANPTTITTAMGDVEGTAFAVWAPNASGVAVIGDFCGWNPSQYPMRSLGSTG
IWELFIPNIGVGTVYKFAIHTHEGHRLDKADPMAKRAEVAPATGSIIASSSYTWNDDTWM
TNRAHTDHDNTAMSVYEVHLGSWSQGQNYEELATNLVDYVKEMGYTHVEFLPVAEHPFGG
SWGYQVSGYYAPTSRWGAPDQLRLLIDAFHQAGIGVIVDWVPAHFPKDAFALGRFDGQAL
YEHPDWRRGEQKDWGTYVFDFGRNEVRNFLVANALYWLEEFHVDGLRVDAVASMLYLDYS
REPGEWLPNIYGGRENLEAVQFLQEMNATVHKSHPGVMTIAEESTSWPGVTSPTWEGGLG
FSMKWNMGWMNDTLEYFSHEPIHRMYHHNDITFSMVYAYSEKFVLPFSHDEVVHGKGSLW
TRMPGDAWNKAAGLRTLYAYMYAHPGKNLLFQGQEFGQVKEWSEERSLDWGDMDGWEGEY
HRGIRTLVQDLNALYKDSPALYSQDNNPAGFSWTKSDDAANNILSFVRYGADGSKILAVF
NFGGADHPSYKLGVPEGGNWKCILNTDAGIYEGADNYLDSDVMAWDTDWDGYQQSLTVHI
PAMSGQLYRWEA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcctactcagatcacaccagtccatcctgatgtcctccacgccctcaaaatc
tgccagtaccacgatccgcacggagtatatggctggcacgaggtagatgctgaacgcgca
gttatccgtacccgccacatcggagcagaacgcgtggaagcattactcagcgactccact
gtggtagagctcgccgccgtaggtgacgacatctttgaagcaatcgttgaccacgatgct
tcctgcgattatcgcctacgaattcactggcaaggtggacaagtaaccgagcaagccgat
gcataccatttcctgccaacgctaggtgatcttgacctccacctcatcaacgaaggccgt
catgagcgactttgggaagtactcggcgcaaacccgaccactatcaccacggccatgggt
gacgttgaaggtactgcctttgcagtctgggcacctaacgcaagcggagttgctgtcatc
ggcgacttctgcggatggaaccccagccaataccctatgcgtagcctcggctcgaccgga
atctgggagctgttcatccctaacattggcgtgggaacagtctacaaatttgcgatccac
acccacgaaggtcatcgtctcgacaaggcagaccccatggcaaagcgtgccgaggtagca
ccggcaaccggctctatcatcgcttcctcctcctacacgtggaatgacgatacatggatg
accaatcgtgcgcacaccgaccacgacaacactgcgatgagcgtctacgaggtccatctt
ggttcatggagccaaggccaaaactacgaggaactagccaccaaccttgtcgactatgtc
aaggaaatgggctatacccacgtggagttcctccctgtagcagagcacccctttggtggt
tcatggggctaccaagtttctggttactacgctcctacctcacgctggggtgccccagat
cagcttcgcttgcttatcgacgccttccaccaagcaggcatcggcgtaatcgtcgactgg
gtaccagcacacttccccaaagatgcctttgcactcggccgcttcgatggtcaagctctt
tacgaacaccctgactggcgccgcggtgaacaaaaagactggggcacctacgttttcgat
ttcggccgcaacgaagtccgcaacttcctcgtcgccaacgctttgtactggctcgaagag
ttccatgtcgatggactccgtgtcgatgctgtggcctccatgctgtatttggactactca
cgcgaacccggtgagtggcttcctaacatctacggtggccgtgaaaacctcgaagctgtt
cagttcctccaagaaatgaacgccaccgtgcacaagagccacccaggcgtgatgaccatt
gctgaagaatccacctcatggccaggagttacctctccaacgtgggaaggcggcctcggt
ttcagcatgaaatggaacatgggctggatgaatgacacactcgaatacttctcacacgag
cctattcatcgcatgtaccaccacaacgacatcacattctccatggtgtacgcatactct
gagaaattcgtgctccccttcagccacgacgaagtagttcacggcaaaggctcgctgtgg
actcgaatgccaggcgacgcatggaacaaagcagcgggtctacgcaccttgtatgcctac
atgtacgctcacccaggcaagaatctgctgttccagggacaagaattcggccaagtgaaa
gaatggtccgaagaacgaagccttgactggggtgacatggacggttgggaaggcgaatac
caccgcggtatccgcaccctagtgcaagacctcaacgcactgtacaaagactcccctgcg
ctctacagccaagacaacaacccagcagggtttagctggacaaagtctgacgacgcagca
aacaacatcttgtctttcgtgcgctacggtgctgatggatccaagatcctagctgtattc
aactttggtggagcagatcacccaagctacaaattaggtgtgcctgaaggcggaaactgg
aagtgcatcctcaacactgatgcaggcatctacgaaggagcagacaactacctcgacagc
gacgtcatggcgtgggacaccgactgggatggctatcagcaatccctcacagtgcatata
cctgcaatgagcggccagctctatcgttgggaagcttaa

DBGET integrated database retrieval system