KEGG   Corynebacterium diphtheriae PW8: CDPW8_1064Help
Entry
CDPW8_1064        CDS       T01701                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDPW8_1064 (pfkA)
   01230 Biosynthesis of amino acids
    CDPW8_1064 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDPW8_1064 (pfkA)
   00030 Pentose phosphate pathway
    CDPW8_1064 (pfkA)
   00051 Fructose and mannose metabolism
    CDPW8_1064 (pfkA)
   00052 Galactose metabolism
    CDPW8_1064 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CDPW8_1064 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CDPW8_1064 (pfkA)
Enzymes [BR:cdw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDPW8_1064 (pfkA)
Protein phosphatases and associated proteins [BR:cdw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CDPW8_1064 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1083967..1084995
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYQDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKSGLDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDIAEICKAMERRFQMGEKYGIIVVAEGALPKEDTMDFAEGGVDQ
FGHQTFNGIGQVIGEEIKKRLGHDVRTTVLGHIQRGGTPTSYDRVLATRYGVHAARACHN
GDYGKMVALHGEHIDLIPLEDAVDTLKTVPDGRYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactcttacatccggcggcgattgccccggcctcaacgctgtgatccgc
ggcattgtccgcacatgttctgagtacggctcgaccgtcgttggataccaagacggctgg
gtggggctcatggaagacaagcgcattcaactatatgacgatgaaaacatcgatcgtatc
ctgttgcgcggcggaaccattttgggtaccggccgccttcaccctgacaagtttaagtct
ggtcttgaccagattaaggcaaaccttgaggatgcaggtattgatgcactgattcctatc
ggtggcgaaggtacacttaagggtgccaaatggctatctgataatggtattcctgtagtt
ggcgtgcctaagacgatcgacaacgacgttaacggtacggattacacttttggctttgat
accgcagtctctgttgctacggatgctatcgaccgactgcacactacagctgagtctcac
aaccgtgtgatgatcgttgaggttatgggtcgtcacgttggctggattgcgctgcacgcc
ggcatggcaggcggtgcgcattacacagtcattcctgagcagccatttgatattgcagag
atctgcaaggcaatggaacgtcgcttccagatgggtgaaaagtacggcattatcgtcgtg
gcggaaggtgcactgcctaaggaagacacgatggactttgccgagggcggcgtcgaccaa
tttggccaccaaacgtttaatggcattggtcaagtaattggtgaggaaatcaagaagcgc
ctcggccatgacgttcgtaccacggttttggggcatatccagcgtggtggcacacctact
tcttatgaccgcgttttggcaacccgttacggtgttcatgcagcacgtgcgtgccacaac
ggtgattacggcaagatggttgcgttgcacggtgaacatatcgatctgattccgctcgag
gacgcggtagatacgctaaagactgtccctgacggacgttaccgcacagcacgcgccctg
tttggctaa

DBGET integrated database retrieval system