KEGG   Corynebacterium diphtheriae PW8: CDPW8_1252Help
Entry
CDPW8_1252        CDS       T01701                                 

Definition
putative methylmalonyl-CoA mutase small subunit
Orthology
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cdw01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cdw00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cdw00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cdw00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1298128..1299939)
Genome map
AA seq 603 aa AA seqDB search
MTDTRIAQTEELEAQRQEWYKAVAKVFARVQKKDVADIPLDIWQRLIRTTYDDIKVNPLY
NRADELEETQIPGAFPYTRGFAGAGQEEGVGWGVTESFGSSSSNKDVIHALDNGTTDVVV
YGEANIEELLKEVLFQYAPVRLNSGVATEEMANRLFSMVDAQGTVPRSIELGASPLSSMI
DGSASVDLDTAINLAVRASERENTRAILVDAVSFSNQGATDAQQIGLALAAGAEYLRGLI
AAGLSTEQALQQLSFRYAITDDQFAQISKLRAGRALWARVAEILGAKELGSAPQHALTAP
VMFTQRDPWVNMLRSTVAAFAAGVGGAKDVEVLCFDWAIAGGIPNVSRSFAHRIARNTNL
LLLEESHLGHVIDPAGGSYYVESLTSSIIEKAWKVFTDIEAAGGFLVAVENGSVKEMLDD
AHERVRRDIAHRIKKVTAINEFPNLAEAPLPAELRVEPTCVRRWAAEFESFRNRSDVFME
VNGKRPQAVLIPLGPLAKHNIRTGFITNLLGTGGIEALNPGQVVPGTPEFAEAAASAKIA
VICGTDAEYDATGAEALAELRKLGVETILLAGSPGHDFEPDDYLNMKIDAATKLDGLLKK
LGA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacacacgaatcgcccaaactgaagagctcgaggctcagcgacaggaatggtat
aaagctgttgctaaagttttcgctcgcgtacagaaaaaagatgttgctgacattccgctc
gatatttggcagcgtcttattcgcaccacgtacgatgacatcaaagtcaaccctttgtat
aaccgtgcagacgaattagaagaaactcagattccaggtgcattcccatatacacgtggt
tttgctggcgcagggcaagaggaaggcgtcggctggggagtaaccgaatcgtttggttcg
tcttcttctaacaaagatgttattcatgcccttgacaatggcacaaccgatgtcgttgtt
tatggagaagccaacattgaagagctcctcaaagaggtgctttttcagtatgccccagtt
cgtctgaactctggtgtcgcgactgaagaaatggctaatcgtcttttctcgatggttgat
gctcagggtaccgtgccacgaagcatcgagcttggagcatcgccgcttagctccatgatc
gatgggtcagcctctgttgacctagacaccgcgattaacctagctgttcgcgcatctgag
cgtgaaaacactcgcgcgatcttggtcgatgcggtttccttctcaaatcaaggtgctacg
gatgcgcagcagattggtctcgcgctagcagccggcgcagaatatctccgtggcttgata
gctgcagggctctctacagagcaagctttacagcagctttcattccgttatgcaattacg
gacgatcagtttgctcaaatttctaaattgcgagcaggccgagcactctgggctcgagtt
gcagaaattcttggcgctaaagaactcggaagtgctccacaacatgcactgacggctcct
gtcatgtttactcagcgtgatccttgggtgaacatgttgcgttccacggtggcagcattc
gctgcaggcgttggtggcgccaaagacgtagaagttttgtgctttgactgggcaattgca
ggcggaattccaaatgtttcgcgcagcttcgctcaccgtattgcgcgtaatacgaacctt
ctgcttctcgaagaatctcacctaggtcatgtgattgacccagctggtggatcgtattac
gtcgaaagtctaacttcatcgatcatcgagaaggcatggaaggtcttcactgatatcgaa
gcagctggtggcttccttgtagccgtcgaaaacggttccgttaaagaaatgcttgacgat
gctcatgagcgagtacgccgtgatattgcgcatcgaatcaagaaggtcaccgcaatcaac
gaatttccaaatctcgcagaagcgccgttgccggcggagcttcgcgtagagccaacctgt
gtacgccgttgggctgcagaattcgagtcgttccgtaaccgctcggatgttttcatggag
gtcaacggaaaacggccacaagctgtactcatcccactaggcccacttgcaaagcacaat
attcgtactggttttattaccaatcttcttggtacaggcggaattgaggctttaaaccca
gggcaggttgttccaggaacccctgagtttgctgaggctgcggctagcgccaagattgca
gtcatttgtggcacggacgctgaatacgatgcaactggtgctgaggcattggctgaactg
cgcaagctcggtgtagaaaccattttgttagcgggatcgccaggacatgatttcgaaccg
gatgactatttgaacatgaagatcgacgcagctacgaagctcgatggtctactgaagaag
ttgggagcttaa

DBGET integrated database retrieval system