KEGG   Corynebacterium diphtheriae PW8: CDPW8_1286Help
Entry
CDPW8_1286        CDS       T01701                                 

Gene name
tpi
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDPW8_1286 (tpi)
   01230 Biosynthesis of amino acids
    CDPW8_1286 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDPW8_1286 (tpi)
   00051 Fructose and mannose metabolism
    CDPW8_1286 (tpi)
   00562 Inositol phosphate metabolism
    CDPW8_1286 (tpi)
Enzymes [BR:cdw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CDPW8_1286 (tpi)
Exosome [BR:cdw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CDPW8_1286 (tpi)
  Exosomal proteins of bladder cancer cells
   CDPW8_1286 (tpi)
  Exosomal proteins of melanoma cells
   CDPW8_1286 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1338364..1339146)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAGTHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtacaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcactgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacact
ggtgaaatctctgcccagatgcttgccaaacttggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagctggttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtatgtgttggagagccccttgaaattcgtgaa
gctggaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttacc
gcagatgatttggcaaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtggcatccgctgccgatgcacaggaagtctgtgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaacctgatgttgatggcggcctggtgggtggc
gcatctctcgacggtgaagcgttcgccaaactagcagctaatgcagcaactgttgttgac
tag

DBGET integrated database retrieval system