KEGG   Corynebacterium diphtheriae PW8: CDPW8_1544Help
Entry
CDPW8_1544        CDS       T01701                                 

Gene name
trpC2
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01130  Biosynthesis of antibiotics
cdw01230  Biosynthesis of amino acids
Module
cdw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDPW8_1544 (trpC2)
Enzymes [BR:cdw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDPW8_1544 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh QRPTase_C PDZ
Motif
Other DBs
NCBI-ProteinID: AEX70196
Position
complement(1618590..1619396)
Genome map
AA seq 268 aa AA seqDB search
MVTVFDEIIAGVVEDVAAREAQVSFQDIKAQSRLCAPPRDACGALLASGCGIIAEVKRAA
PGQGLLAEIPSPVDLALELESGGAALIACHTERRRFHGSLTEMAKIRRHVSVPVMCRDFI
VDPYQIHEARCYGADMVPLRVAALAQSRLVALIDRVESLGMAALVEVRDTAEASRALDAG
ARIIGVNARDFSTMTLNRAAFCEIAPGLPSDVVRVALSGVRNAKELLDYASAGADAVVIG
QSIVTAQSPRAATRALVAAGQHPSCPSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggttacagtcttcgatgagatcatcgctggtgtggtggaagacgttgccgcgcgcgaa
gcgcaggtttcattccaggacatcaaagcgcagtctcgtctgtgcgcgccacctagggat
gcttgtggggcattgttagcaagtggctgtggaatcatcgcggaggtcaaaagggctgca
cctggccaaggtttgcttgcggagattccttcgccggtagatctggctcttgagctcgag
tccggcggtgcggcgttgattgcttgtcacacagagcgccggcggtttcatggttctttg
acggagatggcgaagattcgtcgtcacgtgtccgttccagttatgtgtcgcgattttatt
gttgatccctatcagattcatgaagctcgctgctatggggctgatatggtgccgcttcgg
gtagctgcgcttgcgcagtcacgacttgttgcattgattgatcgggtggagtctctgggg
atggctgcgcttgtcgaggtacgcgatactgcggaggcatcccgtgccttagatgctggt
gctcgaattatcggcgttaatgcgcgagatttttctacgatgacccttaaccgagcggct
ttttgtgagatagctccaggacttcctagcgacgtagtccgagtggcgctttcaggggtt
cgtaatgctaaagagcttttagattacgcctcggctggggcagacgccgtggtgattggt
caaagcatcgtgacggcgcaatcgcctcgggcggcgacgcgtgccttggttgctgcaggc
cagcatccctcgtgtccctcacgttag

DBGET integrated database retrieval system