KEGG   Corynebacterium diphtheriae PW8: CDPW8_1609Help
Entry
CDPW8_1609        CDS       T01701                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00010  Glycolysis / Gluconeogenesis
cdw00052  Galactose metabolism
cdw00500  Starch and sucrose metabolism
cdw00520  Amino sugar and nucleotide sugar metabolism
cdw00521  Streptomycin biosynthesis
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01120  Microbial metabolism in diverse environments
cdw01130  Biosynthesis of antibiotics
cdw01200  Carbon metabolism
Module
cdw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDPW8_1609 (glk)
   00052 Galactose metabolism
    CDPW8_1609 (glk)
   00500 Starch and sucrose metabolism
    CDPW8_1609 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CDPW8_1609 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDPW8_1609 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDPW8_1609 (glk)
Enzymes [BR:cdw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDPW8_1609 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEX70261
Position
complement(1688298..1689251)
Genome map
AA seq 317 aa AA seqDB search
MTNMSESVTVGFDIGGTNMRAAAVTDSGLIIDSVSVPTPKSSEALEKGIISLVAQLREKH
EVSAVGLAVAGFLDPDCEIVRFAPHLPWRDRPVRAELEDALGLPVRLEHDANSAAWGEYR
FGAARGSQNWVLFAVGTGIGATLMHEGEIYRGAFGTAPEFGHLTVVPQGRQCSCGKSGCL
ERYCSGTAIEATARELLDADRGRDSMVAAAYHSGTLSGKTVTEAARQGDVFAIEVFDDFA
EWMGRALSIVCDVLDPGQIVIGGGLSTSSDLFLEKATQHMAQQIVGAGYRPLPTVVCAEL
GGDAGMIGVSDLARRRV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatgtcagaatctgtcactgtcggattcgacatcggtggaaccaatatgcga
gcagcggcggtgacggattccggtttgatcatcgactccgtttcggttcctacccctaaa
tcttctgaggctctggaaaaaggcattatttctctggtagctcaattgcgggaaaagcat
gaggtttcggctgtaggtcttgccgttgcaggttttttggatcctgattgcgaaatcgtt
cgctttgctcctcatctgccgtggcgtgatcgcccagtgcgtgcggaattagaggacgcg
ttgggacttcctgttcgtcttgaacatgatgcgaattctgcagcgtggggagaataccgc
ttcggagcggcacgtggttcgcaaaactgggtcttatttgcggttggcactggtatcggt
gccacactgatgcacgagggtgagatctaccgtggtgcttttggtacagctcctgagttc
ggccaccttaccgttgtccctcaaggtcggcagtgttcttgtggcaagagtggctgtttg
gaacgttattgttccggcactgctattgaagcgacagcgcgtgagcttctcgacgccgat
cgtggccgcgactcgatggttgctgctgcctatcattcgggcacattgagtgggaaaact
gtgaccgaagcggcccgccagggtgatgtttttgccatcgaggtctttgatgattttgct
gaatggatgggccgcgccttgtctatcgtgtgtgatgttttagatccgggacagatcgtg
attggtggcgggttgtccacgtcaagcgatttgttcttggaaaaggctactcagcacatg
gcacagcagattgtcggggctgggtatcgcccccttccgacggtggtgtgtgccgaattg
ggtggcgatgccggtatgatcggggtatctgatctggctcggcgtcgcgtctag

DBGET integrated database retrieval system