KEGG   Corynebacterium diphtheriae PW8: CDPW8_1628Help
Entry
CDPW8_1628        CDS       T01701                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDPW8_1628 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDPW8_1628 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CDPW8_1628 (sucB)
Enzymes [BR:cdw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDPW8_1628 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1709183..1710799
Genome map
AA seq 538 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEQKVEEPQAEAPKAEAADSTDVVMPELGESVTE
GTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRV
GTPGSAPAAKEEPAKEPKAETPKEEPKAEAPKAEPKKEAPAKTINNENVPYVTPLVRKLA
DKHGVDLTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLI
GTTQKVNRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYL
PFFAKAIVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLP
ELAKAIVDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVK
RPVVITEDGIDSIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagcaaaaagtcgaggagccacaagctgaggcaccaaag
gctgaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtccgtcaccgaa
ggcaccatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactc
ctcgaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgctggcaccatc
ctcgaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgtt
ggcaccccaggatctgctccagcagccaaggaagagccagccaaggagccaaaagccgag
acaccaaaggaagagccaaaagctgaggcaccaaaggctgagccaaagaaggaagctcct
gccaagaccatcaacaacgagaacgtcccttacgtcactccgctggtccgcaagctggct
gacaagcacggcgttgatctgaccactgttgaaggcactggtattggtggacgcatccgc
aaacaggatgttttggctgctgctggcgttggcgcagcccctgcagcacaggttgctcct
gcccagccagtttctgcagcatccaccaagtccgtggatccagagaagcagaagctgatc
ggtacaactcagaaggtcaaccgtatccgagagatcaccgcgcgcaagactgtggaggct
ttgcagatttctgctcagctcacccagctgcatgaggtcgatatgactaaggttgcggaa
ctgcgtaaggccaacaagccagccttccaagaaaagcacggtgtgaacctcacctacttg
ccattctttgcaaaggcaattgttgaggctttggttgctcacccgaacgtcaatgcgtcc
tacaacgctgagacaaaggagatgacctaccacgctgatgtcaacctctccatcgccgtt
gataccccagctggtctgcttacccctgttatccacaaggctcaggagttgtccttgcct
gagctcgctaaggcaattgtcgatttggctgaccgtgctcgtaacaacaagctcaagccg
aatgatctttccggtggcaccttcaccattaccaacattggttctgagggcgctctcagc
gataccccaatcttggttccaccacaggcaggtatcttgggtaccggcgctattgttaag
cgtccagtagtcatcacggaagatggcatcgattcgattgctattcgccagatggtctac
ttgccacttagctacgatcaccagatcgtcgatggtgccgatgcaggtcgtttcttgacc
accatcaaggatcgccttgagactgcaaacttcgaaggcgacctcgaactctcctag

DBGET integrated database retrieval system