KEGG   Corynebacterium diphtheriae PW8: CDPW8_1657Help
Entry
CDPW8_1657        CDS       T01701                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDPW8_1657 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDPW8_1657 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CDPW8_1657 (thrC)
Enzymes [BR:cdw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CDPW8_1657 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1740738..1742204)
Genome map
AA seq 488 aa AA seqDB search
MKYISTRDASSTPARFTDILLGGLAPDGGLYLPEQYPQLTAELLEQWRTLLEDKGYAALA
AEVLKLFIDDIPAADIEKITARAYTTPKFSDEDIVPVTKLENNIYIGHLSEGPTAAFKDM
AMQLLGELFEYELGRRGESLNILGATSGDTGSSAEYAMRGRKGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSGDSEFKKNYRIGAVNSINWARLVAQVVYY
ISSWLRVTDSNDQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTYETSSPSMDISRASNFERFVFDLLGRDAGRVADLFGVQVKQGGFSLAQDP
AFAEAANRYGFASGKSTHADRVATIADCYENRGMMIDPHTADGVKVARDWAVDIDSPIVC
LETALPVKFADTICEATGREPEMPERFANIMDAQRRVTDLPNDVAVVKDFIVTSIEETEK
LSSAFCGR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttcaacgcgcgacgcatcatcaacacctgctcgttttaccgatatcttg
cttggtggattagctcccgatggtggcctgtacctgccagaacagtatccacaactgacc
gcagagctgcttgagcagtggcgtacgttgttagaagacaaagggtatgcggcactcgct
gctgaagtattaaagctatttatcgacgacatccccgcggccgatattgaaaaaatcacc
gcccgtgcgtacaccacgcccaagttttctgatgaagacatcgttccagtgacaaaactg
gagaacaacatttatatcggtcatctttcagaaggcccaacggcggcatttaaagacatg
gcaatgcagttgctcggcgaacttttcgaatatgagctagggcgtcgcggcgaatccctg
aatatcctcggtgcaacctccggtgacaccggatcgtctgcggaatacgccatgcgtggc
cgaaaggggatccgcgtttttatgctcacccctgcgggacgtatgaccccattccaacag
gcacagatgttcggtcttgatgacccaaatatctttaatatcgcgctcgatggtgtattc
gacgattgccaagatgtagttaaagcagtgtcgggggattcggaatttaaaaagaactac
cgaatcggagcggtgaactccattaactgggcacgtcttgtagcacaagttgtgtattac
atttcttcttggcttcgcgttaccgatagcaacgatcaaaaagtgagcttttgtgtacca
accggcaacttcggtgacatctgcgcagggcatattgcaaaacagatgggtcttcctatc
gatcgccttatcgttgcaacgaatgaaaatgatgtgctcgatgagtttttccgcaccggc
gattaccgtgtacgcagctctgcagatacgtatgaaacgtcttctccgtccatggacatt
tcgcgtgcttctaactttgaacgctttgtatttgatcttctcggacgagatgcaggcaga
gtagctgatctatttggtgtacaagtcaagcagggtggattcagcttggctcaggaccca
gcattcgccgaggccgcgaatcgttacggatttgcctccggtaaatctacccatgctgat
cgcgttgccacgattgcagactgctacgaaaatcgtggcatgatgatcgaccctcatact
gcggacggtgtgaaagtagcacgagattgggctgtcgacattgattcgccaattgtctgc
cttgaaactgcgcttccagttaagttcgctgacactatctgcgaggcaacagggcgcgaa
cctgagatgccagagcgctttgccaacatcatggatgctcaacgacgtgtaactgatctt
cctaatgacgtagcagtggtcaaagacttcattgtgactagcatcgaggaaaccgaaaaa
ctcagtagtgctttttgtggtcgttga

DBGET integrated database retrieval system