KEGG   Corynebacterium diphtheriae PW8: CDPW8_1718Help
Entry
CDPW8_1718        CDS       T01701                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDPW8_1718 (malQ)
Enzymes [BR:cdw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CDPW8_1718 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805503..1807671
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVEGDPYVFNVHVHDGAPADITITLEDGST
AEVTQVENWTPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYAEHPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQNDVTELAEEFTALNLTPKKIERNPI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCAEQELAVLENSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREELGILTTDVA
TEYAEDLNWQADILNVVRNSGAFESIVPAEFHGVDRADRGSSVDLLSALHRFLAGTPSAL
TCTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENLVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagactctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggatcaaatccgctacgccctacaacagcgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaggcgatccctatgtgttcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactggactccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgatcttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgcttcctcatcgtgaccccggcgcgtctatctacc
gccgacaagtatgcagagcaccctgtcagcggtgttatggcgcagctgtactcggctcgc
agcaagaattcttggggcatgggtgacttcaatgacctcggcttgttggctgagacgctt
gctcctcaggctgattatctgttgattaatcctctgcacgctgctgagccgatgccacca
gttgaggattccccatacttgcctactacgcggcgttttatcaacccaatttatatccgc
atcgaagatatccctgaacacttgcttctcgacgatgacctacaaaatgatgtcaccgaa
cttgcggaagagttcacagcacttaatctcacccctaaaaagattgagcgcaatccaatt
tttgatgccaagttgcaagttctgcacgcggtattcaatgtagagcgcgaaccagcacgt
gaacaggacttccaagacttcatcgccaccgaaggccaaggcctacgagacttcgcttca
tggtgcgcagagcaggagctagcagttttggagaactccgcagcacatgccgctcttccg
gaaaaagaatctcttatccagttctacatgtggcagcagtggatttgcgatcaacagctt
ggtgctgctcaaacccgcgcaaccgacgctggaatgagcatcggtatcatcgccgatctc
gccgtgggcattcaccctgcgggtgccgatgcactttcgcttgccgacaccctagtcgcc
cgcgcttcggtaggtgcgccaccagatagctacaaccaccaaggccaagactggtctcag
ccaccatggcacccagaccgcttggcagagtccggctatatcccatggcgtgacctgctg
cgcacggtgctgcgccacgccggtggtgtccgtgtagaccacattcttggtcttttccgc
ttgttctggattccacgtacgcagtctccacaaacgggtacttacgtcaactacgatcac
aacgcacttgtgggcgtacttgctcttgaggcagagcgtgcaggcgcagtggttatcggt
gaagacctcggtaccttcgagccatgggtccaagacttccttgcgtcccgaggcatcatg
ggtacttcagtgctgtggttcgaaagttccccagaaggtggcccacgcaagcagcatgag
tatcgccaattggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
ctggcaggcgagcacattgcgttgcgtgaggaactcggaattttgaccaccgatgtagca
actgagtatgccgaggatttgaactggcaggcagacatcctcaacgtggttcgcaactcg
ggcgcatttgagtccatcgttcctgccgaattccacggtgtagatcgtgctgaccgcggc
agctccgtcgatttgctttccgcacttcaccgttttttggctggtacgccatcagctctg
acctgcaccgctttggtagatctggtagccgataagcgcgctcaaaaccagccgggtaca
acctcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaacctcgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system