KEGG   Corynebacterium diphtheriae PW8: CDPW8_1812Help
Entry
CDPW8_1812        CDS       T01701                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cdw00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1911646..1912095
Genome map
AA seq 149 aa AA seqDB search
MNALLIIDIHANSPAPEATEITHAIALHLGQHRGDYSHVIVALQGTIADELAGTTFGNQF
IKDPATQALSAFERTDATGTKLGDWLRANNIDRLDVVGLGTELGIRSSVLDALAQGFDVH
VHKKLCAAVSHDNARAAYNEMDMCGALFE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttcttattatcgatatccacgccaactcccctgcccccgaggccaccgag
atcacccacgccatcgccctacatctcggccagcaccgcggcgactactcccacgtcatc
gtagctcttcaaggcactatcgccgatgagctagccggtactacctttggcaatcaattc
attaaagaccccgccacccaggccttatccgcttttgagcgcacagatgccaccggcacc
aaactcggcgactggctccgtgccaacaacatagatcgcctcgacgttgtaggccttggc
accgaactcggcattcgctccagcgtgttagacgcactcgcccaaggatttgatgtgcac
gtgcacaaaaaactctgcgctgccgtatcacacgacaacgcccgcgctgcctataacgaa
atggacatgtgcggggcgttattcgaataa

DBGET integrated database retrieval system