KEGG   Corynebacterium diphtheriae PW8: CDPW8_2268Help
Entry
CDPW8_2268        CDS       T01701                                 

Definition
putative DNA repair glycosylase
Organism
cdw  Corynebacterium diphtheriae PW8
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2427570..2428424
Genome map
AA seq 284 aa AA seqDB search
MPEGHVIHRLADQLNQHFASTQATPDAQPHRPLLVTSPQGRFVAEAAQLNGHALDHAEAW
GKHLFLCFDSDNPAHIVHIHLGLIGSMRLEDPADVWGQIRFRIEDPKQPTTSAVAANLRG
PQWCRLITEAEMTTATAKLGADPLRDDANFLAIKTKVARSRRSIGSLLMDQKLFAGVGNI
YRAETLFRLGISPFILGKDVAELDLIWQDLRFLMREGVNRGRIDTVRPEHTPEAMGRPPR
KDDHGGEVYVYRRYGQPCYVCGTPILERTMEGRNLFWCPTCQPD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaggtcacgtcatccatcgcctcgcagaccaactcaaccagcatttcgccagc
acacaggcaacaccggacgcacaaccccaccgcccactactggtcacctccccacaaggt
cgctttgtcgcagaggccgcccaactcaacggtcatgcactcgaccacgccgaggcatgg
ggcaaacaccttttcctctgctttgatagcgataacccagcccacatcgtccacatccac
ctcgggcttatcggaagcatgcgcttagaagacccagccgatgtgtggggtcagattcga
ttccggatcgaagacccaaaacaacccaccaccagcgcggtagcagcaaacctgcgcggc
cctcagtggtgcaggttgattacggaggcagaaatgaccaccgccaccgcaaagctcggc
gccgatccgctacgcgacgacgccaacttcctagcaatcaaaacaaaagtggcgcgctcg
cgtcgcagtatcggttccctgctgatggaccagaaactctttgccggcgtaggcaatatc
taccgtgccgaaacactcttccgcctgggaattagcccctttatcctcggcaaagatgta
gcagagctcgacctcatctggcaggacctgcgttttcttatgcgcgagggggtgaacagg
ggtcggattgatactgttcgcccggagcacacaccggaggcgatggggcggccgccacgc
aaggatgaccacggtggcgaggtatatgtgtatcgccgctatggtcagccgtgttatgtg
tgtggcacgccgatccttgagcgcacgatggagggtcgtaatcttttttggtgtcctacc
tgccaacctgattag

DBGET integrated database retrieval system