KEGG   Corynebacterium diphtheriae PW8: CDPW8_2268Help
Entry
CDPW8_2268        CDS       T01701                                 

Definition
(RefSeq) putative DNA repair glycosylase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CDPW8_2268
Enzymes [BR:cdw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CDPW8_2268
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CDPW8_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2427570..2428424
Genome map
AA seq 284 aa AA seqDB search
MPEGHVIHRLADQLNQHFASTQATPDAQPHRPLLVTSPQGRFVAEAAQLNGHALDHAEAW
GKHLFLCFDSDNPAHIVHIHLGLIGSMRLEDPADVWGQIRFRIEDPKQPTTSAVAANLRG
PQWCRLITEAEMTTATAKLGADPLRDDANFLAIKTKVARSRRSIGSLLMDQKLFAGVGNI
YRAETLFRLGISPFILGKDVAELDLIWQDLRFLMREGVNRGRIDTVRPEHTPEAMGRPPR
KDDHGGEVYVYRRYGQPCYVCGTPILERTMEGRNLFWCPTCQPD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaggtcacgtcatccatcgcctcgcagaccaactcaaccagcatttcgccagc
acacaggcaacaccggacgcacaaccccaccgcccactactggtcacctccccacaaggt
cgctttgtcgcagaggccgcccaactcaacggtcatgcactcgaccacgccgaggcatgg
ggcaaacaccttttcctctgctttgatagcgataacccagcccacatcgtccacatccac
ctcgggcttatcggaagcatgcgcttagaagacccagccgatgtgtggggtcagattcga
ttccggatcgaagacccaaaacaacccaccaccagcgcggtagcagcaaacctgcgcggc
cctcagtggtgcaggttgattacggaggcagaaatgaccaccgccaccgcaaagctcggc
gccgatccgctacgcgacgacgccaacttcctagcaatcaaaacaaaagtggcgcgctcg
cgtcgcagtatcggttccctgctgatggaccagaaactctttgccggcgtaggcaatatc
taccgtgccgaaacactcttccgcctgggaattagcccctttatcctcggcaaagatgta
gcagagctcgacctcatctggcaggacctgcgttttcttatgcgcgagggggtgaacagg
ggtcggattgatactgttcgcccggagcacacaccggaggcgatggggcggccgccacgc
aaggatgaccacggtggcgaggtatatgtgtatcgccgctatggtcagccgtgttatgtg
tgtggcacgccgatccttgagcgcacgatggagggtcgtaatcttttttggtgtcctacc
tgccaacctgattag

DBGET integrated database retrieval system