KEGG   Corynebacterium diphtheriae PW8: CDPW8_2330Help
Entry
CDPW8_2330        CDS       T01701                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDPW8_2330 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDPW8_2330 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDPW8_2330 (trpB1)
Enzymes [BR:cdw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDPW8_2330 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2497253..2498605
Genome map
AA seq 450 aa AA seqDB search
MTDSTIRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAETGA
GQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDAID
VALMDWVKNLDTTHYLIGSAVGPHPFPTLVKEFQAVISLESREQILELTGKLPDAVIAAV
GGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSFIL
ADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGIIP
ALESSHALAYALKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSPVT
DPHVAETLATMIAESKVDSIGCRNTLSMEV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccatccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgctaacctccccctagcaggtaaggggaaggcgcgg
atcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcaggtgctt
gcccaggcgttgattgctcgccgattgggtaagactcgtttgattgcagaaaccggtgct
ggtcagcacggtaccgccactgcaatggtggcggctttgatgggaatggactgcaccatt
tatatgggtgctaaagacgtggcccgccagcagcccaatgtgtatcgcatgcggctcatg
ggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgctatcgac
gtagcgcttatggactgggtgaaaaacctagataccacgcactacctgattggttctgcg
gtcggtccacatccgttccctacgctggtcaaggagtttcaggcggttatttcgctggaa
tctcgcgaacagatactggagctaacaggcaagcttccggacgcagtgattgctgccgta
ggcggtggttcgaatgctattggtgcgtttgccgattatctcacggataagccaggtaat
gagtcggtgcgtttgattggtgtggagccagcaggtgagggtcttgattccggtaagcat
ggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttcatcttg
gctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgattatccg
ggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcacaatattatggaatt
accgatgccgaggcgcttcaggcattccgaatgctaagccgctacgagggtatcattcca
gctttggagtctagccatgcgttggcctatgccctaaagatggcggaaaacgctgaggaa
accgatactcccattaacatagtggtcaatctttcaggtcgtggcgataaagatgtggac
tatgttcgcaatatcttgggcgacctcgctaccgaggatccagcaacctcaccagtcacg
gatcctcatgtcgccgaaaccctcgccacaatgatcgctgagtccaaggtggattcaatt
ggttgtcgcaacaccctgagcatggaggtgtga

DBGET integrated database retrieval system