KEGG   Corynebacterium diphtheriae PW8: CDPW8_2330Help
Entry
CDPW8_2330        CDS       T01701                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00260  Glycine, serine and threonine metabolism
cdw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01130  Biosynthesis of antibiotics
cdw01230  Biosynthesis of amino acids
Module
cdw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDPW8_2330 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDPW8_2330 (trpB1)
Enzymes [BR:cdw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDPW8_2330 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEX70973
Position
2497253..2498605
Genome map
AA seq 450 aa AA seqDB search
MTDSTIRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAETGA
GQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDAID
VALMDWVKNLDTTHYLIGSAVGPHPFPTLVKEFQAVISLESREQILELTGKLPDAVIAAV
GGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSFIL
ADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGIIP
ALESSHALAYALKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSPVT
DPHVAETLATMIAESKVDSIGCRNTLSMEV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccatccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgctaacctccccctagcaggtaaggggaaggcgcgg
atcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcaggtgctt
gcccaggcgttgattgctcgccgattgggtaagactcgtttgattgcagaaaccggtgct
ggtcagcacggtaccgccactgcaatggtggcggctttgatgggaatggactgcaccatt
tatatgggtgctaaagacgtggcccgccagcagcccaatgtgtatcgcatgcggctcatg
ggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgctatcgac
gtagcgcttatggactgggtgaaaaacctagataccacgcactacctgattggttctgcg
gtcggtccacatccgttccctacgctggtcaaggagtttcaggcggttatttcgctggaa
tctcgcgaacagatactggagctaacaggcaagcttccggacgcagtgattgctgccgta
ggcggtggttcgaatgctattggtgcgtttgccgattatctcacggataagccaggtaat
gagtcggtgcgtttgattggtgtggagccagcaggtgagggtcttgattccggtaagcat
ggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttcatcttg
gctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgattatccg
ggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcacaatattatggaatt
accgatgccgaggcgcttcaggcattccgaatgctaagccgctacgagggtatcattcca
gctttggagtctagccatgcgttggcctatgccctaaagatggcggaaaacgctgaggaa
accgatactcccattaacatagtggtcaatctttcaggtcgtggcgataaagatgtggac
tatgttcgcaatatcttgggcgacctcgctaccgaggatccagcaacctcaccagtcacg
gatcctcatgtcgccgaaaccctcgccacaatgatcgctgagtccaaggtggattcaatt
ggttgtcgcaacaccctgagcatggaggtgtga

DBGET integrated database retrieval system