KEGG   Corynebacterium diphtheriae PW8: CDPW8_2335Help
Entry
CDPW8_2335        CDS       T01701                                 

Gene name
trpC1
Definition
indole-3-glycerol phosphate synthase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdw01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cdw00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2503335..2504765
Genome map
AA seq 476 aa AA seqDB search
MPTVLESIVSGRRSHLPEIQARISHVDPARLLRSTRSLFQSLGGRSDGGPALRGSARFIM
ECKSSSPSLGMIREDYRPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATVAAATHLPVL
CKDFIIHPVQVHAASYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTEVIDEVEVER
AIRLGATIFGINHRNLHDLSIDLNRSAHLAQLIPDSAVIVSESGIRDNETVRQLSGHSSA
FLVGSQLTSQPDVDRAARELVYGHNKVCGLQSPSEVQAARTSGAIYGGLIFEESSPRNVS
RETSKKIMAAEPELTYIAVSRRTTGWAEIIGDNIAVAQIHSPYQGSIAAEKELISHVRGE
VGDKVKIWRAISMTHADGPLVAEALAPKVDRLVLDTGNGGTGTTFDWARIPEAIKGKALL
AGGIGPDNVTEALAVGCAGLDLNSGLEYPAEAGKWATHKDAAAIHSTFTQIRGFHY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgtcctagaatccatcgtttcgggccgacgatcccacctgcccgaaatccaa
gcgcggatttctcacgtggacccggcgcgactactgcgttccacccgctcgctgtttcag
tcgttgggaggccgtagcgatggcggtccggcgttgcgggggagtgcgcgcttcatcatg
gagtgtaagtcctcttcgccgtcgcttggcatgattcgtgaggattatcgccctggcgac
atcgcgcgggtgtattcacgttatgcggccggcatttcggtgttgtgcgagccggatcgt
tttggtggcgactacaaccatctggccacggtggcggctgccacgcatcttccagtgtta
tgcaaggattttattatccaccctgtgcaggttcacgcggccagttattttggggcggac
gcaattttgctcatgttgagtgtgcttgacgacgctacctacaccgagctcagccaggaa
gcagcacgcttggggttggatgttctcaccgaggttatcgacgaggttgaggtggaacgt
gccattcggttgggggccacaatctttggcattaatcatcgcaatctgcatgatttgagc
attgatttgaatcgctcagcacaccttgcgcagctgattcccgatagcgccgtgattgtc
tccgagtctggcattcgggataacgagacggttcgccaactcagtggacactccagtgcg
ttcctcgtgggctcgcaacttacttctcagccagatgtggaccgtgcggcccgtgagctt
gtgtacggccacaataaggtgtgcggtttgcagtcgccaagcgaggtgcaagcagcgcgc
acatcgggtgcaatctatggcggattgatcttcgaggagtctagcccgcgtaatgtttca
cgtgaaacatcgaaaaaaatcatggctgccgaacccgaacttacctacatcgccgtctca
cgacgcaccaccggatgggccgaaatcataggtgacaacatcgccgttgctcagatccac
agtccctaccagggctccattgccgccgaaaaagaactcatcagtcacgtccgcggcgag
gtaggagacaaggtaaaaatctggcgcgcaatctccatgacgcatgccgacggaccactt
gtcgccgaagcactcgcacccaaggtagacagactcgtcctcgacaccggcaatggtgga
accggcaccaccttcgattgggcacgcatcccagaagccataaaaggcaaggctcttctc
gccggcggcattggaccagacaatgtcaccgaggcgctcgccgttggctgcgcaggactc
gatctcaactccgggttggaatatccagccgaagcggggaagtgggcaacacacaaagac
gctgctgcaatccactccactttcacccaaatacgtgggtttcattactaa

DBGET integrated database retrieval system