KEGG   Corynebacterium diphtheriae 31A: CD31A_0254Help
Entry
CD31A_0254        CDS       T01697                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CD31A_0254 (recR)
DNA repair and recombination proteins [BR:cdz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CD31A_0254 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250820..251476
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDEFSRLPGVGPKSAQRIAFHLLHVEPADITRLQDALGAIRDGVTFCRICC
NISREEVCRICADSSRDRSTICVVEEPKDIQVIERTGEYTGRYHVLGGSLDPLANIGPRE
LNISQLLQRIGGVLPDRELADSTPETPLYDASPEVREVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggacctctccaagacctgatcgacgagttttctcggctccctggtgtgggg
ccgaagtcggctcagcgcattgctttccacctgctccatgtggaaccagcagacattacg
cgtctgcaagatgcgctgggtgctattcgtgacggtgttactttctgccgcatttgctgc
aatatctctcgcgaagaggtctgccgcatttgtgcggactcttcacgcgaccgcagcacc
atctgtgtggtggaagaacccaaagacattcaggttattgaacgaaccggcgagtacaca
ggtcgctaccatgtgctcggcggctcgcttgacccccttgccaacattggcccccgtgag
ctcaacatttcgcaattattgcagcgtatcggcggcgtgttgccagaccgcgaacttgcg
gactccacccccgagacaccgctttacgacgcctccccagaagtgcgcgaggttatcctc
gccaccgaccccaacaccgaaggcgaagccacagcctcctacctagcgcggctgctgcgc
gacttcccagaccttgtggtgtcacgccttgcctctggcatgccactcggcggcgacttg
gagttcgttgacgaacttaccttgtcccgtgcgctaagtgggcgtcttacgctttaa

DBGET integrated database retrieval system