KEGG   Corynebacterium diphtheriae 31A: CD31A_0390Help
Entry
CD31A_0390        CDS       T01697                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00010  Glycolysis / Gluconeogenesis
cdz00260  Glycine, serine and threonine metabolism
cdz00680  Methane metabolism
cdz01100  Metabolic pathways
cdz01110  Biosynthesis of secondary metabolites
cdz01120  Microbial metabolism in diverse environments
cdz01130  Biosynthesis of antibiotics
cdz01200  Carbon metabolism
cdz01230  Biosynthesis of amino acids
Module
cdz_M00002  Glycolysis, core module involving three-carbon compounds
cdz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD31A_0390 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CD31A_0390 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD31A_0390 (gpmA)
Enzymes [BR:cdz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CD31A_0390 (gpmA)
Membrane trafficking [BR:cdz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CD31A_0390 (gpmA)
Exosome [BR:cdz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CD31A_0390 (gpmA)
  Exosomal proteins of melanoma cells
   CD31A_0390 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX41074
Position
391019..391765
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
caattcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtttacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccattggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaacaag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttat
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtgcagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system