KEGG   Corynebacterium diphtheriae 31A: CD31A_0409Help
Entry
CD31A_0409        CDS       T01697                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cdz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409366..410718
Genome map
AA seq 450 aa AA seqDB search
MRIAIIGAGLAGLTAAYRLRDHDVSVFEATDRIGGKLHTVAFQSGPTDMGAEAYLAFRED
TTAFFKELGLEVVSPSGLPSLLYVNGELHPMPMNTVMGIPGSSKGLEKLVSAETAARIDA
ESDSMDWPQEVTLGEVLRERFGDDLVDHVVSALQGGVYSSTSDDLSLRDTVPQLARALDR
LKEEGKPVTITAAVQSIMADREKRNKARGYKPSVFAAFPGGYAELYEALAEKSGAKIHID
AFITGIQWKDGFTLTGAEGTFDKVIVAVPAPTAAMLLKSVAPEASALLKNIKLASSAVVG
MKFDSAEGLPDNSGILVATDAEVTAKAFTFSSKKWPHLGQRGGALVRASFGRFGDDAIAR
ADEDLLVDTALDDLQTITGFDGRAAGLSEIYVQRWFGGLPVYGPGHSDLVAAIKDALPVG
IYATGAWADGVGVPAVIDSATKVAKLLEDH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattgcaatcattggtgcggggcttgcgggtttgactgcggcgtatcgtcttcgt
gaccatgatgtttcggttttcgaggcgactgaccgtattggtggcaagctgcatacggtt
gcgtttcagtctggccctacggatatgggcgcagaggcgtatttggcgtttcgtgaggat
acgacggccttttttaaggagttaggtcttgaggttgtgtcgccttcggggttgccgtcg
ttgttgtatgtcaatggtgagttgcatccgatgccgatgaatacggtgatggggattcca
ggctcgtcgaagggtttggaaaagttggtgagcgcggagactgccgcgcgtatcgacgcc
gaatctgattccatggactggccccaggaggtgactctgggggaggttttgcgtgagcgc
tttggcgatgacctggtggatcacgtggtgtcggcgttgcaaggtggtgtgtattcttcg
acgtctgatgatctttcgttgcgggacacggttccgcagttggcgcgtgcgttggatcgt
ctgaaagaagaaggcaagccagtgacaattaccgctgcggtgcagtcgattatggctgat
cgtgagaagcgtaataaggcccgtggttataagccgagtgtttttgcggctttccctggt
ggttatgcggagctgtatgaggcgctggcggagaagtcgggtgcgaagatccacattgat
gcctttattactggcattcagtggaaggatgggttcacgctgacgggtgctgagggaacc
tttgacaaggtgattgtggcggttccagctccgacggcggcgatgttgttgaagtctgtg
gcaccggaggcgtcggcgttgctgaaaaacatcaagttggcgagctctgcggtggtgggc
atgaagttcgattccgcggaggggctgccggataattcgggcattttggttgctacggat
gcagaggttactgcgaaggcgtttacattttcttcgaagaagtggccgcatttggggcag
cgtggtggcgcgttggtgcgtgcgtcgtttggccgttttggtgatgatgccattgcgcgt
gccgacgaagacctgctggtggataccgcccttgatgatcttcagactattacgggtttt
gatggccgtgcggctgggctgtcggagatctatgtgcagcgctggttcggtggcttgccg
gtgtacggcccagggcatagcgatcttgtggctgcgattaaggacgcactgccagtaggt
atttatgccaccggcgcttgggctgatggcgtgggtgttcctgcggtgattgattctgca
actaaggtggcaaagctactggaagatcactga

DBGET integrated database retrieval system