KEGG   Corynebacterium diphtheriae 31A: CD31A_0835Help
Entry
CD31A_0835        CDS       T01697                                 

Definition
putative folate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD31A_0835
   00670 One carbon pool by folate
    CD31A_0835
Enzymes [BR:cdz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CD31A_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(826285..826788)
Genome map
AA seq 167 aa AA seqDB search
MLRAIWAQSTDGVIGDGNDMPWHVPEDLAYFKATTLGAPVIMGRTTWTTIPERFRPLPGR
RNFVLSSRAPGAWSTGAEVVTAIPELDCDAWIMGGGAVYTSTLPLVNEVVITLIDATLAP
VLGDAAVYAPALDDSFEVVEESPWQQSASGTVLGTPARYKFQRLRRR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgcgatttgggctcagtccactgatggggtgattggcgatggcaacgacatg
ccctggcatgttcccgaagacctcgcctatttcaaggccaccactttgggcgcacctgtg
attatgggtcgcaccacgtggactacgatcccagaacgcttccgcccgctgccagggcgt
cgtaactttgtgctctcctcccgagcacccggcgcgtggagcacgggtgccgaggtcgtc
actgcaatccccgagctcgactgcgatgcatggatcatgggcggcggcgccgtctacaca
agcacacttccgctggtaaacgaggtagtgatcacgcttatcgacgccaccctcgctccc
gtactcggcgacgcagcagtatatgcaccagccctcgacgatagctttgaggttgttgag
gaatccccatggcagcaatctgcttccgggaccgtgctgggtactccggcccgctataag
ttccaaaggttgcgcaggcgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system