KEGG   Corynebacterium diphtheriae 31A: CD31A_0988Help
Entry
CD31A_0988        CDS       T01697                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cdz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980910..982007
Genome map
AA seq 365 aa AA seqDB search
MLDLTTNPIDLTRALVDIESPSHYEKNIADAIEQALHAIDNVEVLRHGNTLVARTHRGLG
ERVILAGHIDTVPIADNVPSHMEGDVMFGCGTVDMKSGMAVYLHAFATLANHPALAKDLT
VVCYEGEEVASEYNGLGHVQAAHPDWLSGDLALLGEPSGAVIEAGCQGTIRLRVTAHGVR
AHSARSWLGDNAMHKLAPVITNIAQYDAQEVLVDGCLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPNRSVDEALAHMLEVLDLPEGVTYDIDDAVPGARPGLDRPAAAALLEATGG
KFRAKYGWTDVSRFSEIGVPAVNFGPGDPAYCHKKDEQCPVSMITEVSRTLVHYLTSTNF
QTTGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttgactacaaatcccattgacctcacccgcgcacttgttgatatagaaagc
ccctcccattacgaaaagaacatagccgacgccatcgagcaggctcttcatgccatcgac
aatgttgaagtgctacgccacggcaatactcttgttgctcggacccatcgaggactagga
gaaagagtaatcctcgccggccacattgacaccgtcccaatagccgacaacgttcctagc
cacatggaaggcgacgtaatgttcggctgcggcaccgtcgatatgaaatcgggcatggct
gtctatcttcatgcctttgccaccttggctaaccacccagcgctggcgaaggacttgacc
gtcgtctgttatgagggcgaggaagtcgctagtgaatacaacgggctggggcatgtgcag
gcagctcaccccgactggttaagtggcgatctcgccctcctaggcgagccttccggtgct
gtgatcgaagctgggtgccaaggaacgattcgtttgcgcgtcaccgcccatggtgtgcgc
gcacactcggcacggtcgtggctaggagacaacgccatgcacaaattagcgccagttatt
acgaatatcgcacaatacgacgcccaagaagtgcttgtcgacggctgcctctaccacgag
ggcctcaacatcgtgcattgcgaatctggagttgccacgaacactatccccgatgaggcc
tggatgtttgttaacttccgtttcgcacctaataggagtgttgacgaagccctagcccac
atgctggaggtgttggatctacccgagggggtgacctatgacatcgacgatgctgttcca
ggggcacgtccgggtttggatcgtccggcagctgccgccctcctagaggcgacaggcgga
aaattccgcgcaaagtacggttggacggatgtgtcgaggttttctgagattggtgttcca
gcggtgaactttggtcctggggatccggcatattgccataaaaaagacgaacaatgccca
gtcagcatgattaccgaagtctctcgcacgctggtgcactatctcacgagtacgaatttc
cagacgacaggagcctga

DBGET integrated database retrieval system